Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KMEGSRGRLRGGLGWESSLRQRPM2.1.1.37;DNA (cytosine-5-)-methyltransferase. 162
  • Gene: DNM3A
EEASPPA2.1.1.37;DNA (cytosine-5-)-methyltransferase. 240
  • Gene: DNM3A
VATTPEPV2.1.1.37;DNA (cytosine-5-)-methyltransferase. 258
  • Gene: DNM3A
GIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMW2.1.1.37;DNA (cytosine-5-)-methyltransferase. 291
  • Gene: DNM3A
WFGDGKFS2.1.1.37;DNA (cytosine-5-)-methyltransferase. 330
  • Domain: PWWP
SAFHQATYNKQPMYRKAIYEVLQVASSRAGK2.1.1.37;DNA (cytosine-5-)-methyltransferase. 352
  • Gene: DNM3A
NPYKEVYT2.1.1.37;DNA (cytosine-5-)-methyltransferase. 430
  • Gene: DNM3A
EKPKVKEIIDERTRERLVYEVRQKCRNIEDICISCGSLNV2.1.1.37;DNA (cytosine-5-)-methyltransferase. 463
  • Gene: DNM3A
DGYQSYCT2.1.1.37;DNA (cytosine-5-)-methyltransferase. 531 -
CCRCFCVEC2.1.1.37;DNA (cytosine-5-)-methyltransferase. 554 -
YGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKR2.1.1.37;DNA (cytosine-5-)-methyltransferase. 592
  • Gene: DNM3A
PIRVLSLFDGIATG2.1.1.37;DNA (cytosine-5-)-methyltransferase. 633 -
EWGPFDLVIGGSPCNDLS2.1.1.37;DNA (cytosine-5-)-methyltransferase. 697
  • Active Site C=Cysteine at location 710 on the protein
  • Active Site Description: By similarity.
VNPARKGLYEGTGRLFFEFY2.1.1.37;DNA (cytosine-5-)-methyltransferase. 716 -
RPKEGDDRPFFW2.1.1.37;DNA (cytosine-5-)-methyltransferase. 742 -
FENVVAM2.1.1.37;DNA (cytosine-5-)-methyltransferase. 755 -
DKRDISRFLE2.1.1.37;DNA (cytosine-5-)-methyltransferase. 765 -
VSAAHRARYFWGNLPGMNRP2.1.1.37;DNA (cytosine-5-)-methyltransferase. 785 -
SNSIKQGK2.1.1.37;DNA (cytosine-5-)-methyltransferase. 837 -
HYTDVSNM2.1.1.37;DNA (cytosine-5-)-methyltransferase. 873 -
LLGRSWSVPVIRHLFAPLK2.1.1.37;DNA (cytosine-5-)-methyltransferase. 888 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPVESGDTPKDPAVISKSPSMAQDSGASELLPNGDLEKRSEPQ
PEEGSPAGGQKGGAPAEGEGAAETLPEASRAVENGCCTPKEGRGAPAEAGKEQKETNIESM
KMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISK
RKRDEWLARWKREAEKKAKVIAGMNAVEENQGPGESQKV
EEASPPAVQQPTDPASPTVATTPEPVGSDAGDKNATKAGDDEPEYEDGRGFGIGELVWGKL
RGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFS
VVCVEKLMPLSSFCSAFHQATYNKQPMYRKAIYEVLQVASSRAGKLFPVCHDSDESDTAKAVE
VQNKPMIEWALGGFQPSGPKGLEPPEEEK
NPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTAEKPKVKEIIDERTRERLVYEVRQKCRNIEDICISCGSL
NV
TLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRRED
WPSRLQMFFANNHDQEFDPPKVYPPVPAEKR
KPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGP
FDLVIGGSPCNDLS
IVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPG
MNRP
LASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRH
LFAPLK
EYFACV



DME EC Prediction for this protein is: 2.1.1.37
Check another protein