Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LTVRWTVSL2.4.1;Hexosyltransferases. 15
  • Gene: ALG6
SYSGAGKPPM2.4.1;Hexosyltransferases. 25
  • Gene: ALG6
KPPMFGDYEAQRHW2.4.1;Hexosyltransferases. 31
  • Gene: ALG6
HKLFMRTTV2.4.1;Hexosyltransferases. 108
  • Gene: ALG6
ADLLIYIPAV2.4.1;Hexosyltransferases. 119
  • Gene: ALG6
GHFQYNSVSLGFALWGVL2.4.1;Hexosyltransferases. 162
  • Gene: ALG6
NYKQMELYH2.4.1;Hexosyltransferases. 198
  • Gene: ALG6
DRGLFEDKVANIWCS2.4.1;Hexosyltransferases. 267
  • Gene: ALG6
TLVSCALSFFLFSFQVHEKSILLVS2.4.1;Hexosyltransferases. 328
  • Gene: ALG6
TWFLLVSTFSMLPLLLKD2.4.1;Hexosyltransferases. 367
  • Gene: ALG6

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MEKWYLMTVVVLIGLTVRWTVSLNSYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVAKFINPDWIALHTS
RGYESQA
HKLFMRTTVLIADLLIYIPAVVLYCCCLKEISTKKKIANALCILLYPGLILIDYGHFQYNSVSLGFALWGVLGISCDCDLLGSLAFCLAINYK
QMELYH
ALPFFCFLLGKCFKKGLKGKGFVLLVKLACIVVASFVLCWLPFFTEREQTLQVLRRLFPVDRGLFEDKVANIWCSFNVFLKIKDILPRHIQLIM
SFCSTFLSLLPACIKLILQPSSKGFKF
TLVSCALSFFLFSFQVHEKSILLVSLPVCLVLSEIPFMSTWFLLVSTFSMLPLLLKDELLMPSVVTTMAFFIA
CVTSFSIFEKTSEEELQLKSFSISVRKYLPCFTFLSRIIQYLFLISVITMVLLTLMTVTLDPPQKLPDLFSVLVCFVSCLNFLFFLVYFNIIIMWDSKSG
RNQKKIS



DME EC Prediction for this protein is: 2.4.1
Check another protein