Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
VDRLEVVNK3.4.24;Metalloendopeptidases. 185 -
VWFNIGSVDTFERNLE3.4.24;Metalloendopeptidases. 212 -
GGLFSVGETTAK3.4.24;Metalloendopeptidases. 286 -
GAKIPKG3.4.24;Metalloendopeptidases. 337 -
AGEANVPF3.4.24;Metalloendopeptidases. 362 -
EMFVGVG3.4.24;Metalloendopeptidases. 379 -
FIDEIDAVG3.4.24;Metalloendopeptidases. 405 -
GGQSEQENTLNQ3.4.24;Metalloendopeptidases. 422 -
TLNQLLVE3.4.24;Metalloendopeptidases. 430 -
LVEMDGF3.4.24;Metalloendopeptidases. 435 -
PDILDPAL3.4.24;Metalloendopeptidases. 456 -
ALLRPGRFDR3.4.24;Metalloendopeptidases. 462 -
SIFKVHLRPLKLD3.4.24;Metalloendopeptidases. 485 -
TPGFSGA3.4.24;Metalloendopeptidases. 513 -
HFEQAIERV3.4.24;Metalloendopeptidases. 544 -
AYHEAGH3.4.24;Metalloendopeptidases. 572
  • Active Site E=Glutamic acid at location 575 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 574 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
GHAVAGW3.4.24;Metalloendopeptidases. 577
  • Metal Site H=Histidine at location 578 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
DPLLKVSIIPR3.4.24;Metalloendopeptidases. 589 -
LGYAQYLP3.4.24;Metalloendopeptidases. 603 -
GRVSEEIFFG3.4.24;Metalloendopeptidases. 631 -
GAQDDLRKVT3.4.24;Metalloendopeptidases. 645 -
EKPYSEATA3.4.24;Metalloendopeptidases. 686 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAHRCLRLWGRGGCWPRGLQQLLVPGGVGPGEQPCLRTLYRFVTTQARASRNSLLTDIIAAYQRFCSRPPKGFEKYFPNGKNGKKASEPKEVMGEKKESK
PAATTRSSGGGGGGGGKRGGKKDDSHWWSRFQKGDIPWDDKDFRMFFLWTALFWGGVMFYLLLKRSGREITWKDFVNNYLSKGV
VDRLEVVNKRFVRVTF
TPGKTPVDGQY
VWFNIGSVDTFERNLETLQQELGIEGENRVPVVYIAESDGSFLLSMLPTVLIIAFLLYTIRRGPAGIGRTGRGMGGLFSVGETTAKVLK
DEIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDL
GAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVSGSEFLEMFVGVGPARVRDLFALARKNA
PCIL
FIDEIDAVGRKRGRGNFGGQSEQENTLNQLLVEMDGFNTTTNVVILAGTNRPDILDPALLRPGRFDRQIFIGPPDIKGRASIFKVHLRPLKLDSTL
EKDKLARKLASL
TPGFSGADVANVCNEAALIAARHLSDSINQKHFEQAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPRG
KG
LGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYAQIVQFGMNEKVGQISFDLPRQGDMVLEKPYSEATARLIDDE
VRILINDAYKRTVALLTEKKADVEKVALLLLEKEVLDKNDMVELLGPRPFAEKSTYEEFVEGTGSLDEDTSLPEGLKDWNKEREKEKEEPPGEKVAN



DME EC Prediction for this protein is: 3.4.24
Check another protein