Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
TGTPGVGK2.7.4.3;Adenylate kinase. 9
  • Gene: KAD6
NVGDLARE2.7.4.3;Adenylate kinase. 33
  • Gene: KAD6
CPILDEDRV2.7.4.3;Adenylate kinase. 53
  • Gene: KAD6
VDYHGCD2.7.4.3;Adenylate kinase. 76
  • Gene: KAD6
DNIQCEIFQVL2.7.4.3;Adenylate kinase. 118
  • Gene: KAD6

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTN
VLYERLETRGYNEKKLT
DNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS



DME EC Prediction for this protein is: 2.7.4.3
Check another protein