Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
QFTNCRILRGG3.5.1.25;N-acetylglucosamine-6-phosphate deacetylase. 14
  • Gene: NAGA
LLREDLWVRGGRILDPEKLFFEERRVADE3.5.1.25;N-acetylglucosamine-6-phosphate deacetylase. 26
  • Gene: NAGA
GVTSFCPTLVTSP3.5.1.25;N-acetylglucosamine-6-phosphate deacetylase. 102
  • Gene: NAGA
PQIPVKSGGPHGAGVLG3.5.1.25;N-acetylglucosamine-6-phosphate deacetylase. 123
  • Gene: NAGA
THLFNAM3.5.1.25;N-acetylglucosamine-6-phosphate deacetylase. 231
  • Gene: NAGA
PAALRIA3.5.1.25;N-acetylglucosamine-6-phosphate deacetylase. 275
  • Gene: NAGA
GRHTLGQQ3.5.1.25;N-acetylglucosamine-6-phosphate deacetylase. 304
  • Gene: NAGA
ATYISGELVWQ3.5.1.25;N-acetylglucosamine-6-phosphate deacetylase. 393
  • Gene: NAGA

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MRGEQGAAGARVLQFTNCRILRGGKLLREDLWVRGGRILDPEKLFFEERRVADERRDCGGRILAPGFIDVQINGGFGVDFSQATEDVGSGVALVARRILS
H
GVTSFCPTLVTSPPEVYHKVVPQIPVKSGGPHGAGVLGLHLEGPFISREKRGAHPEAHLRSFEADAFQDLLATYGPLDNVRIVTLAPELGRSHEVIRAL
TARGICVSLGHSVADLRAAEDAVWSGATFI
THLFNAMLPFHHRDPGIVGLLTSDRLPAGRCIFYGMIADGTHTNPAALRIAHRAHPQGLVLVTDAIPALG
LGN
GRHTLGQQEVEVDGLTAYVAGTKTLSGSIAPMDVCVRHFLQATGCSMESALEAASLHPAQLLGLEKSKGTLDFGADADFVVLDDSLHVQATYISGEL
VWQ
ADAARQ



DME EC Prediction for this protein is: 3.5.1.25
Check another protein