Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KFGVKAR3.4.17;Metallocarboxypeptidases. 148
  • Gene: CBPC1
LDTLAALLKS3.4.17;Metallocarboxypeptidases. 224
  • Gene: CBPC1
VRTLDPLVNTSSLIMRKCFPKNRLPLPTIKS3.4.17;Metallocarboxypeptidases. 308
  • Gene: CBPC1
FNSKFESGNL3.4.17;Metallocarboxypeptidases. 712 -
EYDLILNSDINSNHYHQWFYFEV3.4.17;Metallocarboxypeptidases. 731
  • Gene: CBPC1
FNIINCEK3.4.17;Metallocarboxypeptidases. 764 -
MYSVQEA3.4.17;Metallocarboxypeptidases. 784
  • Gene: CBPC1
ICYYKNH3.4.17;Metallocarboxypeptidases. 804 -
HKDDVCYFAYHYPYTYS3.4.17;Metallocarboxypeptidases. 837
  • Gene: CBPC1
ARVHPGE3.4.17;Metallocarboxypeptidases. 917
  • Metal Site H=Histidine at location 920 on the protein
  • Metal Site Description: Zinc (By similarity).
PMLNPDGV3.4.17;Metallocarboxypeptidases. 957 -
YGCSIKET3.4.17;Metallocarboxypeptidases. 1028 -
SPTTYVL3.4.17;Metallocarboxypeptidases. 1168
  • Gene: CBPC1
EEVDYSAESND3.4.17;Metallocarboxypeptidases. 1183
  • Gene: CBPC1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSKLKVIPEKSLTNNSRIVGLLAQLEKINAEPSESDTARYVTSKILHLAQSQEKTRREMTAKGSTGMEILLSTLENTKDLQTTLNILSILVELVSAGGGR
RVSFLVTKGGSQILLQLLMNASKESPPHEDLMVQIHSILAKIGPKDK
KFGVKARINGALNITLNLVKQNLQNHRLVLPCLQLLRVYSANSVNSVSLGKNG
VVELMFKIIGPFSKKNSSLIKVA
LDTLAALLKSKTNARRAVDRGYVQVLLTIYVDWHRHDNRHRNMLIRKGILQSLKSVTNIKLGRKAFIDANGMKILYN
TSQECLA
VRTLDPLVNTSSLIMRKCFPKNRLPLPTIKSSFHFQLPVIPVTGPVAQLYSLPPEVDDVVDESDDNDDIDVEAENETENEDDLDQNFKNDDIE
TDINKLKPQQEPGRTIEDLKMYEHLFPELVDDFQDYDLISKEPKPFVFEGKVRGPIVVPTAGEETSGNSGNLRKVVMKENISSKGDEGEKKSTFMDLAKE
DIKDNDRTLQQQPGDQNRTISSVHGLNNDIVKALDRITLQNIPSQTAPGFTAEMKKDCSLPLTVLTCAKACPHMATCGNVLFEGRTVQLGKLCCTGVETE
DDEDTESNSSVEQASVEVPDGPTLHDPDLYIEIVKNTKSVPEYSEVAYPDYFGHIPPPFKEPILERPYGVQRTKIAQDIERLIHQSDIIDRVVYDLDNPN
YTIPEEGDILK
FNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRPGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALNARPWWIRM
GTD
ICYYKNHFSRSSVAAGGQKGKSYYTITFTVNFPHKDDVCYFAYHYPYTYSTLQMHLQKLESAHNPQQIYFRKDVLCETLSGNSCPLVTITAMPESNY
YEHICHFRNRPYVFLS
ARVHPGETNASWVMKGTLEYLMSNNPTAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQSPSPDLHPTIYHAKGLL
QYLAAVKRLPLVYCDYHGHSRKKNVFM
YGCSIKETVWHTNDNATSCDVVEDTGYRTLPKILSHIAPAFCMSSCSFVVEKSKESTARVVVWREIGVQRSYT
MESTLCGCDQGKYKGLQIGTRELEEMGAKFCVGLLRLKRLTSPLEYNLPSSLLDFENDLIESSCKVT
SPTTYVLDEDEPRFLEEVDYSAESNDELDIELA
ENVGDYEPSAQEEVLSDSELSRTYLP



DME EC Prediction for this protein is: 3.4.17
Check another protein