Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
VETLVVAD3.4.24.82;ADAMTS-4 endopeptidase. 244
  • Domain: Peptidase M12B
AHELGHSFGIQHDG3.4.24;Metalloendopeptidases. 387
  • Active Site E=Glutamic acid at location 389 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 388 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
  • Domain: Peptidase M12B
EDRCGVC3.4.24;Metalloendopeptidases. 684 -
LTSPGPT3.4.24;Metalloendopeptidases. 779 -
VWIQLLFQ3.4.24;Metalloendopeptidases. 789 -
EEEAPEL3.4.24;Metalloendopeptidases. 1046 -
CHLRPCA3.4.24;Metalloendopeptidases. 1458
  • Domain: TSP type-1
CSRSCGGG3.4.24.82;ADAMTS-4 endopeptidase. 1474
  • Domain: TSP type-1
LRPFHCQ3.4.24;Metalloendopeptidases. 1498
  • Domain: TSP type-1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MPGGPSPRSPAPLLRPLLLLLCALAPGAPGPAPGRATEGRAALDIVHPVRVDAGGSFLSYELWPRALRKRDVSVRRDAPAFYELQYRGRELRFNLTANQH
LLAPGFVSETRRRGGLGRAHIRAHTPACHLLGEVQDPELEGGLAAISACDGLKGVFQLSNEDYFIEPLDSAPARPGHAQPHVVYKRQAPERLAQRGDSSA
PSTCGVQVYPELESRRERWEQRQQWRRPRLRRLHQRSVSKEKW
VETLVVADAKMVEYHGQPQVESYVLTIMNMVAGLFHDPSIGNPIHITIVRLVLLEDE
EEDLKITHHADNTLKSFCKWQKSINMKGDAHPLHHDTAILLTRKDLCAAMNRPCETLGLSHVAGMCQPHRSCSINEDTGLPLAFTV
AHELGHSFGIQHDG
SGNDCEPVGKRPFIMSPQLLYDAAPLTWSRCSRQYITRFLDRGWGLCLDDPPAKDIIDFPSVPPGVLYDVSHQCRLQYGAYSAFCEDMDNVCHTLWCSVG
TTCHSKLDAAVDGTRCGENKWCLSGECVPVGFRPEAVDGGWSGWSAWSICSRSCGMGVQSAERQCTQPTPKYKGRYCVGERKRFRLCNLQACPAGRPSFR
HVQCSHFDAMLYKGQLHTWVPVVNDVNPCELHCRPANEYFAEKLRDAVVDGTPCYQVRASRDLCINGICKNVGCDFEIDSGAM
EDRCGVCHGNGSTCHTV
SGTFEEAEGLGYVDVGLIPAGAREIRIQEVAEAANFLALRSEDPEKYFLNGGWTIQWNGDYQVAGTTFTYARRGNWEN
LTSPGPTKEPVWIQLLFQESNP
GVHYEYTIHREAGGHDEVPPPVFSWHYGPWTKCTVTCGRGVQRQNVYCLERQAGPVDEEHCDPLGRPDDQQRKCSEQPCPARWWAGEWQLCSSSCGPGGL
SRRAVLCIRSVGLDEQSALEPPACEHLPRPPTETPCNRHVPCPATWAVGNWSQCSVTCGEGTQRRNVLCTNDTGVPCDEAQQPASEVTCSLPLCRWPLGT
LGPEGSGSGSSSHELFNEADFIPHHLAPRPSPASSPKPGTMGNAI
EEEAPELDLPGPVFVDDFYYDYNFINFHEDLSYGPSEEPDLDLAGTGDRTPPPHS
HPAAPSTGSPVPATEPPAAKEEGVLGPWSPSPWPSQAGRSPPPPSEQTPGNPLINFLPEEDTPIGAPDLGLPSLSWPRVSTDGLQTPATPESQNDFPVGK
DSQSQLPPPWRDRTNEVFKDDEEPKGRGAPHLPPRPSSTLPPLSPVGSTHSSPSPDVAELWTGGTVAWEPALEGGLGPVDSELWPTVGVASLLPPPIAPL
PEMKVRDSSLEPGTPSFPTPGPGSWDLQTVAVWGTFLPTTLTGLGHMPEPALNPGPKGQPESLSPEVPLSSRLLSTPAWDSPANSHRVPETQPLAPSLAE
AGPPADPLVVRNAGWQAGNWSECSTTCGLGAVWRPVRCSSGRDEDCAPAGRPQPARR
CHLRPCATWHSGNWSKCSRSCGGGSSVRDVQCVDTRDLRPLRP
FHCQ
PGPAKPPAHRPCGAQPCLSWYTSSWRECSEACGGGEQQRLVTCPEPGLCEEALRPNTTRPCNTHPCTQWVVGPWGQCSGPCGGGVQRRLVKCVNTQ
TGLPEEDSDQCGHEAWPESSRPCGTEDCEPVEPPRCERDRLSFGFCETLRLLGRCQLPTIRTQCCRSCSPPSHGAPSRGHQRVARR



DME EC Prediction for this protein is: 3.4.24.82
Check another protein