Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GAPGSGKGT2.7.4;Phosphotransferases with a phosphate group as acceptor. 14 -
SSGDLLR2.7.4;Phosphotransferases with a phosphate group as acceptor. 37
  • Binding Site S=Serine at location 38 on the protein
  • Binding site description: AMP (By similarity).
WLLDGFPR2.7.4;Phosphotransferases with a phosphate group as acceptor. 87 -
LDGFPRT2.7.4;Phosphotransferases with a phosphate group as acceptor. 89 -
YQIDTVINLNVPFEVIK2.7.4.10;Nucleoside-triphosphate--adenylate kinase. 106
  • Gene: KAD3
SGRVYNIEFNPPKT2.7.4.10;Nucleoside-triphosphate--adenylate kinase. 134
  • Gene: KAD3
TGEPLIQR2.7.4;Phosphotransferases with a phosphate group as acceptor. 154 -
QREDDKP2.7.4;Phosphotransferases with a phosphate group as acceptor. 160 -
DDKPETV2.7.4;Phosphotransferases with a phosphate group as acceptor. 163 -
FSGTETN2.7.4;Phosphotransferases with a phosphate group as acceptor. 196 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAE
ALDRA
YQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTE
TN
KIWPYVYAFLQTKVPQRSQKASVTP



DME EC Prediction for this protein is: 2.7.4.10
Check another protein