Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GLKHYLLT3.4.24.82;ADAMTS-4 endopeptidase. 277
  • Domain: Peptidase M12B
KHPSIRN3.4.24.82;ADAMTS-4 endopeptidase. 294
  • Domain: Peptidase M12B
DTAILFTRQ3.4.24.82;ADAMTS-4 endopeptidase. 351
  • Domain: Peptidase M12B
CDTLGMADVGT3.4.24.82;ADAMTS-4 endopeptidase. 367
  • Domain: Peptidase M12B
CDPSRSCS3.4.24;Metalloendopeptidases. 379
  • Domain: Peptidase M12B
SCSVIED3.4.24;Metalloendopeptidases. 384
  • Domain: Peptidase M12B
VIEDDGL3.4.24;Metalloendopeptidases. 387
  • Domain: Peptidase M12B
AHELGHVF3.4.24.82;ADAMTS-4 endopeptidase. 400
  • Active Site E=Glutamic acid at location 402 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 401 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
  • Domain: Peptidase M12B
HFPWADGTSCGEGK3.4.24;Metalloendopeptidases. 525
  • Domain: Disintegrin
PWGDCSR3.4.24.82;ADAMTS-4 endopeptidase. 567
  • Domain: TSP type-1
CSRTCGGGV3.4.24.82;ADAMTS-4 endopeptidase. 571
  • Domain: TSP type-1
GQCVKAGCD3.4.24;Metalloendopeptidases. 694 -
SKKKFDKC3.4.24.82;ADAMTS-4 endopeptidase. 707 -
DKCGVCGG3.4.24.14;Procollagen N-endopeptidase. 712 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MQRAVPEGFGRRKLGSDMGNAERAPGSRSFGPVPTLLLLAAALLAVSDALGRPSEEDEELVVPELERAPGHGTTRLRLHAFDQQLDLELRPDSSFLAPGF
TLQNVGRKSGSETPLPETDLAHCFYSGTVNGDPSSAAALSLCEGVRGAFYLLGEAYFIQPLPAASERLATAAPGEKPPAPLQFHLLRRNRQGDVGGTCGV
VDDEPRPTGKAETEDEDEGTEGEDEGAQWSPQDPALQGVGQPTGTGSIRKKRFVSSHRYVETMLVADQSMAEFHGS
GLKHYLLTLFSVAARLYKHPSIRN
SVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDTAILFTRQDLCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTA
HELGHVF
NMPHDDAKQCASLNGVNQDSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPQNPIQLPGDLPGTSYDANRQCQFTFGEDSKHCP
DAASTCSTLWCTGTSGGVLVCQTK
HFPWADGTSCGEGKWCINGKCVNKTDRKHFDTPFHGSWGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEG
KRVRYRSCNLEDCPDNNGKTFREEQCEAHNEFSKASFGSGPAVEWIPKYAGVSPKDRCKLICQAKGIGYFFVLQPKVVDGTPCSPDSTSVCVQ
GQCVKAG
CD
RIIDSKKKFDKCGVCGGNGSTCKKISGSVTSAKPGYHDIITIPTGATNIEVKQRNQRGSRNNGSFLAIKAADGTYILNGDYTLSTLEQDIMYKGVVLR
YSGSSAALERIRSFSPLKEPLTIQVLTVGNALRPKIKYTYFVKKKKESFNAIPTFSAWVIEEWGECSKSCELGWQRRLVECRDINGQPASECAKEVKPAS
TRPCADHPCPQWQLGEWSSCSKTCGKGYKKRSLKCLSHDGGVLSHESCDPLKKPKHFIDFCTMAECS



DME EC Prediction for this protein is: 3.4.24.82
Check another protein