Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
FLPPPECPVFEP1.14.11;With 2-oxoglutarate as one donor 26 -
PPPECPVFEPSW1.14.11;With 2-oxoglutarate as one donor 28 -
TGICKVRPPPDWQPPFACDVD1.14.11;With 2-oxoglutarate as one donor 59
  • Domain: JmjN
QRLNELEA1.14.11;With 2-oxoglutarate as one donor 88 -
VERKILDL1.14.11;With 2-oxoglutarate as one donor 123
  • Domain: ARID
MGFAPGKAVGSH1.14.11;With 2-oxoglutarate as one donor 159
  • Domain: ARID
DKEYKPH1.14.11;With 2-oxoglutarate as one donor 205 -
LLCDGCDDSYHTFCL1.14.11;With 2-oxoglutarate as one donor 325 -
EAFGFEQA1.14.11;With 2-oxoglutarate as one donor 366 -
DYFNMPVHMVPTE1.14.11;With 2-oxoglutarate as one donor 392 -
EKEFWRLV1.14.11;With 2-oxoglutarate as one donor 407 -
EDVTVEYGAD1.14.11;With 2-oxoglutarate as one donor 419 -
EQSVLAHI1.14.11;With 2-oxoglutarate as one donor 468
  • Domain: JmjC
PWLYVGM1.14.11;With 2-oxoglutarate as one donor 485
  • Domain: JmjC
YSINYLH1.14.11;With 2-oxoglutarate as one donor 506
  • Binding Site N=Asparagine at location 509 on the protein
  • Binding site description: Alpha-ketoglutarate (By simila
  • Domain: JmjC
GEPKTWY1.14.11;With 2-oxoglutarate as one donor 514
  • Binding Site K=Lysine at location 517 on the protein
  • Binding site description: Alpha-ketoglutarate (By simila
  • Domain: JmjC
VMKKLAPELF1.14.11;With 2-oxoglutarate as one donor 533
  • Domain: JmjC
SQPDLLHQLVTIMNPN1.14.11;With 2-oxoglutarate as one donor 544
  • Domain: JmjC
MNPNTLM1.14.11;With 2-oxoglutarate as one donor 556
  • Domain: JmjC
RTNQCAGEFV1.14.11;With 2-oxoglutarate as one donor 570
  • Domain: JmjC
NFAEAVNF1.14.11;With 2-oxoglutarate as one donor 595
  • Domain: JmjC
RYCVFSH1.14.11;With 2-oxoglutarate as one donor 623 -
FELLPDDERQC1.14.11;With 2-oxoglutarate as one donor 682 -
KCKTTCF1.14.11;With 2-oxoglutarate as one donor 694 -
LRYRYTLD1.14.11;With 2-oxoglutarate as one donor 732 -
SVAQQLLNGKRQTRYR1.14.11;With 2-oxoglutarate as one donor 812 -
LLEVLCP1.14.11;With 2-oxoglutarate as one donor 1086 -
SLQRIRVRLPEGDALRYMIER1.14.11;With 2-oxoglutarate as one donor 1238 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MEAATTLHPGPRPALPLGGPGPLGEFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVK
LNFLDQIAKYWELQGSTLKIPH
VERKILDLFQLNKLVAEEGGFAVVCKDRKWTKIATKMGFAPGKAVGSHIRGHYERILNPYNLFLSGDSLRCLQKPNLT
TDTK
DKEYKPHDIPQRQSVQPSETCPPARRAKRMRAEAMNIKIEPEETTEARTHNLRRRMGCPTPKCENEKEMKSSIKQEPIERKDYIVENEKEKPKSRS
KKATNAVDLYVCLLCGSGNDEDRL
LLCDGCDDSYHTFCLIPPLHDVPKGDWRCPKCLAQECSKPQEAFGFEQAARDYTLRTFGEMADAFKSDYFNMPVHM
VPTE
LVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDGKIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHI
EDHWS
YSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAV
NF
CTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCF
MSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAESYNEWALNVNEALEAKINKKKSLVSFKALIEESEMKKFPDNDLLRHL
RLVTQDAEKCA
SVAQQLLNGKRQTRYRSGGGKSQNQLTVNELRQFVTQLYALPCVLSQTPLLKDLLNRVEDFQQHSQKLLSEETPSAAELQDLLDVSFEF
DVELPQLAEMRIRLEQARWLEEVQQACLDPSSLTLDDMRRLIDLGVGLAPYSAVEKAMARLQELLTVSEHWDDKAKSLLKARPRHSLNSLATAVKEIEEI
PAYLPNGAALKDSVQRARDWLQDVEGLQAGGRVPVLDTLIELVTRGRSIPVHLNSLPRLETLVAEVQAWKECAVNTFLTENSPYS
LLEVLCPRCDIGLLG
LKRKQRKLKEPLPNGKKKSTKLESLSDLERALTESKETASAMATLGEARLREMEALQSLRLANEGKLLSPLQDVDIKICLCQKAPAAPMIQCELCRDAFH
TSCVAVPSISQGLRIWLCPHCRRSEKPPLEKILPLLA
SLQRIRVRLPEGDALRYMIERTVNWQHRAQQLLSSGNLKFVQDRVGSGLLYSRWQASAGQVSD
TNKVSQPPGTTSFSLPDDWDNRTSYLHSPFSTGRSCIPLHGVSPEVNELLMEAQLLQVSLPEIQELYQTLLAKPSPAQQTDRSSPVRPSSEKNDCCRGKR
DGINSLERKLKRRLEREGLSSERWERVKKMRTPKKKKIKLSHPKDMNNFKLERERSYELVRSAETHSLPSDTSYSEQEDSEDEDAICPAVSCLQPEGDEV
DWVQCDGSCNQWFHQVCVGVSPEMAEKEDYICVRCTVKDAPSRK



DME EC Prediction for this protein is: 1.14.11
Check another protein