Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RFRGCLAGALLGDC3.2.1.143;Poly(ADP-ribose) glycohydrolase. 22
  • Gene: ARHL2
YTDDTAM3.2.1.143;Poly(ADP-ribose) glycohydrolase. 75
  • Metal Site T=Threonine at location 76 on the protein
  • Metal Site Description: Magnesium 1 (By similarity).
  • Gene: ARHL2
GNGGAMR3.2.1.143;Poly(ADP-ribose) glycohydrolase. 150
  • Gene: ARHL2
SLGYNGA3.2.1.143;Poly(ADP-ribose) glycohydrolase. 185
  • Gene: ARHL2
ELGNGIAA3.2.1.143;Poly(ADP-ribose) glycohydrolase. 266
  • Gene: ARHL2
AFESVPTAIY3.2.1.143;Poly(ADP-ribose) glycohydrolase. 273
  • Gene: ARHL2
TIATMAGAIAGAYYG3.2.1.143;Poly(ADP-ribose) glycohydrolase. 317
  • Metal Site T=Threonine at location 317 on the protein
  • Metal Site Description: Magnesium 2 (By similarity).
  • Gene: ARHL2

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAAAAMAAAAGGGAGAARSLSRFRGCLAGALLGDCVGSFYEAHDTVDLTSVLRHVQSLEPDPGTPGSERTEALYYTDDTAMARALVQSLLAKEAFDEVDM
AHRFAQEYKKDPDRGYGAGVVTVFKKLLNPKCRDVFEPARAQFNGKGSY
GNGGAMRVAGISLAYSSVQDVQKFARLSAQLTHASSLGYNGAILQALAVHL
ALQGESSSEHFLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVS
ELGNGIAAFESVPTAIYCFLRCMEPDPEIPSAFNS
LQRTLIYSISLGGDTD
TIATMAGAIAGAYYGMDQVPESWQQSCEGYEETDILAQSLHRVFQKS



DME EC Prediction for this protein is: 3.2.1.143
Check another protein