Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
VWLRDHCRSASCYN1.14.11.8;Trimethyllysine dioxygenase. 74
  • Gene: TMLH
QRSLDTASVDL1.14.11.8;Trimethyllysine dioxygenase. 92
  • Gene: TMLH
FLQNFLLYGIAFVENV1.14.11.8;Trimethyllysine dioxygenase. 180
  • Gene: TMLH
HTDTTYF1.14.11.8;Trimethyllysine dioxygenase. 242
  • Gene: TMLH
CHNHMIG1.14.11.8;Trimethyllysine dioxygenase. 308
  • Gene: TMLH
ELYLIRYNNYDRAVINTVPYDVV1.14.11.8;Trimethyllysine dioxygenase. 327
  • Gene: TMLH
LFIDNWRVLHGRE1.14.11.8;Trimethyllysine dioxygenase. 380
  • Gene: TMLH

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MWYHRLSHLHSRLQDLLKGGVIYPALPQPNFKSLLPLAVHWHHTASKSLTCAWQQHEDHFELKYANTVMRFDYVWLRDHCRSASCYNSKTHQRSLDTASV
DL
CIKPKTIRLDETTLFFTWPDGHVTKYDLNWLVKNSYEGQKQKVIQPRILWNAEIYQQAQVPSVDCQSFLETNEGLKKFLQNFLLYGIAFVENVPPTQE
HTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDR
HTDTTYFQEPCGIQVFHCLKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHE
YIEDVGE
CHNHMIGIGPVLNIYPWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWVKLKPGRVLFIDNWRVLHGRECFTGYRQL
CGCYLTRDDVLNTARLLGLQA



DME EC Prediction for this protein is: 1.14.11.8
Check another protein