Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
HVKATWAQRCNK2.4.1.122;Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase. 106
  • Gene: C1GLT
HYLEDADWF2.4.1.122;Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase. 157
  • Gene: C1GLT
KADDDTY2.4.1.122;Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase. 167 -
SGGAGYVLS2.4.1.122;Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase. 208 -
HSSSIEDLALG2.4.1.122;Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase. 234
  • Gene: C1GLT
EGPGCCSD2.4.1.122;Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase. 296
  • Gene: C1GLT
YHLRPYG2.4.1.122;Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase. 324
  • Gene: C1GLT

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MASKSWLNFLTFLCGSAIGFLLCSQLFSILLGEKVDTQPNVLHNDPHARHSDDNGQNHLEGQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNL
EKKAK
HVKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIKAFQYVHEHYLEDADWFLKADDDTYVILDNLRWLLSKYDPEEPIYFGRRFKP
YVKQGYM
SGGAGYVLSKEALKRFVDAFKTDKCTHSSSIEDLALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC
CSD
LAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP



DME EC Prediction for this protein is: 2.4.1.122
Check another protein