Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GLLKSQFLCHLVFCYVFIASGLI2.3.1.51;1-acylglycerol-3-phosphate O-acyltransferase. 5
  • Gene: PLCD
WPINKQLFRKIN2.3.1.51;1-acylglycerol-3-phosphate O-acyltransferase. 39
  • Gene: PLCD
NKQLFRKINCRLSYC2.3.1.51;1-acylglycerol-3-phosphate O-acyltransferase. 42
  • Gene: PLCD
SQLVMLLEWWS2.3.1.51;1-acylglycerol-3-phosphate O-acyltransferase. 59 -
FEIDFLCGW2.3.1.51;1-acylglycerol-3-phosphate O-acyltransferase. 98 -
SKVLAKKEL2.3.1.51;1-acylglycerol-3-phosphate O-acyltransferase. 118 -
AVYDCTLNFRNNENPTLLGVLNGKKYHAD2.3.1.51;1-acylglycerol-3-phosphate O-acyltransferase. 224
  • Gene: PLCD
WLHKLYQEKDA2.3.1.51;1-acylglycerol-3-phosphate O-acyltransferase. 273 -
RTGTFPETP2.3.1.51;1-acylglycerol-3-phosphate O-acyltransferase. 290
  • Gene: PLCD
VPPRRPW2.3.1.51;1-acylglycerol-3-phosphate O-acyltransferase. 300
  • Gene: PLCD
LYPFFQFLVSM2.3.1.51;1-acylglycerol-3-phosphate O-acyltransferase. 319
  • Gene: PLCD
SGSSLTLASF2.3.1.51;1-acylglycerol-3-phosphate O-acyltransferase. 332
  • Gene: PLCD

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEI
DFLCGW
SLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRL
KHHLLPRTKGFAITVRSLRNVVS
AVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMV
PPRRPW
TLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAYGNSDSKQKLND



DME EC Prediction for this protein is: 2.3.1.51
Check another protein