Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
MEGVRWAFSCGTWLPS2.7.8;Transferases for other substituted phosphate groups. 14
  • Gene: ADPPT
RSIQPEEKERIG2.7.8;Transferases for other substituted phosphate groups. 38
  • Binding Site R=Arginine at location 47 on the protein
  • Binding site description: Coenzyme A (By similarity).
  • Gene: ADPPT
SHQGDYAVLAAEP2.7.8;Transferases for other substituted phosphate groups. 110
  • Gene: ADPPT
QVGIDIMKTSFPGRGSIPEFFHIMKRKFT2.7.8;Transferases for other substituted phosphate groups. 125
  • Metal Site D=Aspartic acid at location 129 on the protein
  • Metal Site Description: Magnesium (By similarity).
  • Gene: ADPPT
FTILNFNDL2.7.8;Transferases for other substituted phosphate groups. 269
  • Gene: ADPPT

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSN
PYPNFNFNI
SHQGDYAVLAAEPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEF
DLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQ
FTILNFNDLMSSAVPMTPEDPSFWDCFCFTEE
IPIRNGTKS



DME EC Prediction for this protein is: 2.7.8
Check another protein