Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
IYMPMIPE6.2.1.1;Acetate--CoA ligase. 165 -
AMLACAR6.2.1.1;Acetate--CoA ligase. 176 -
MLACARIGA6.2.1.1;Acetate--CoA ligase. 177 -
LFILYTSGSTG6.2.1.1;Acetate--CoA ligase. 311 -
LYTSGSTG6.2.1;Acid--thiol ligases. 314 -
LYTSGSTGKPKGV6.2.1.1;Acetate--CoA ligase. 314 -
TFKYVFD6.2.1.1;Acetate--CoA ligase. 340
  • Gene: ACSA
WCTADIGW6.2.1.1;Acetate--CoA ligase. 354 -
YGPLANG6.2.1.1;Acetate--CoA ligase. 370 -
FEGIPTYP6.2.1.1;Acetate--CoA ligase. 382
  • Gene: ACSA
YTAPTAIR6.2.1.1;Acetate--CoA ligase. 407 -
VGEPINP6.2.1.1;Acetate--CoA ligase. 438 -
WYHRVVG6.2.1.1;Acetate--CoA ligase. 449
  • Gene: ACSA
WQTETGG6.2.1.1;Acetate--CoA ligase. 466 -
DGYYWITGR6.2.1.1;Acetate--CoA ligase. 559 -
VAEAAVV6.2.1.1;Acetate--CoA ligase. 594 -
AEAAVVG6.2.1.1;Acetate--CoA ligase. 595 -
SGKIMRR6.2.1.1;Acetate--CoA ligase. 659
  • Binding Site K=Lysine at location 661 on the protein
  • Binding site description: ATP (By similarity).

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGLPEERVRSGSGSRGQEEAGAGGRARSWSPPPEVSRSAHVPSLQRYRELHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGAT
TNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSNVLRKQGIQKGDRVA
IYMPMIPELVVAMLACARIGALHSIVFAGFSSESLC
ERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQISWNQGIDLWWHELMQEAGDEC
EPEWCDAEDP
LFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHAEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTYPDVNRLWSIVDK
YKVTKF
YTAPTAIRLLMKFGDEPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGAQRCPIVDTFWQTETGGHMLTPLPGATPMKPGSATFPFFGVAPAI
LNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHERFETTYFKKFPGYYVTGDGCQRDQ
DGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVV
G
HPHPVKGECLYCFVTLCDGHTFSPKLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQNDHDLGDMSTVADPSVISHLFSHRCLTI
Q



DME EC Prediction for this protein is: 6.2.1.1
Check another protein