Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
CSVESAA2.4.1.228;Lactosylceramide 4-alpha-galactosyltransferase. 96 -
LGISLLSCFPNV2.4.1.228;Lactosylceramide 4-alpha-galactosyltransferase. 128
  • Gene: A4GAT
LPVLSDASRIAL2.4.1.228;Lactosylceramide 4-alpha-galactosyltransferase. 171
  • Gene: A4GAT
WKFGGIYLDTDFIVLKNL2.4.1.228;Lactosylceramide 4-alpha-galactosyltransferase. 184
  • Gene: A4GAT
HEFMALCM2.4.1.228;Lactosylceramide 4-alpha-galactosyltransferase. 227
  • Gene: A4GAT
YNGWIWGHQGPQLLTRVFKKWCSI2.4.1.228;Lactosylceramide 4-alpha-galactosyltransferase. 241
  • Gene: A4GAT
ESRACRGVT2.4.1.228;Lactosylceramide 4-alpha-galactosyltransferase. 269
  • Gene: A4GAT
LPPEAFYPIPWQ2.4.1.228;Lactosylceramide 4-alpha-galactosyltransferase. 279
  • Gene: A4GAT
ALLAQLHARYCPTTH2.4.1.228;Lactosylceramide 4-alpha-galactosyltransferase. 332
  • Gene: A4GAT

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSKPPDLLLRLLRGAPRQRVCTLFIIGFKFTFFVSIMIYWHVVGEPKEKGQLYNLPAEIPCPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVES
AA
RTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLDLRELFRDTPLADWYAAVQGRWEPYLLPVLSDASRIALMWKFGGIYLDTDFIVLKN
L
RNLTNVLGTQSRYVLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDIN
PEELPRLLSATYAVHVWNKKSQGTRFEATSR
ALLAQLHARYCPTTHEAMKMYL



DME EC Prediction for this protein is: 2.4.1.228
Check another protein