Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SVTDPERFW6.2.1.1;Acetate--CoA ligase. 69 -
DPERFWGKAAEQISWYKPWTKTLE6.2.1.1;Acetate--CoA ligase. 72
  • Gene: ACSS3
GDKIAIIYDSPVT6.2.1.1;Acetate--CoA ligase. 126
  • Gene: ACSS3
YKEVLEQVSKLAGVLVK6.2.1.1;Acetate--CoA ligase. 146
  • Gene: ACSS3
VVIYMPM6.2.1.1;Acetate--CoA ligase. 171 -
MLACARIGA6.2.1.1;Acetate--CoA ligase. 185 -
RIGAIHS6.2.1;Acid--thiol ligases. 190 -
ILYTSGTTG6.2.1;Acid--thiol ligases. 296 -
VPGYNVMILDDNMQKLKAR6.2.1.1;Acetate--CoA ligase. 479
  • Gene: ACSS3
RVDDVINV6.2.1.1;Acetate--CoA ligase. 554
  • Active Site D=Aspartic acid at location 556 on the protein
  • Active Site Description: By similarity.
VADCAVVGKED6.2.1.1;Acetate--CoA ligase. 581
  • Gene: ACSS3
VLEEIVKHVRQ6.2.1.1;Acetate--CoA ligase. 615
  • Gene: ACSS3

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MKPSWLQCRKVTSAGGLGGPLPGSSPARGAGAALRALVVPGPRGGLGGRGCRALSSGSGSEYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSP
STRWFVEGMLNICYNAVDRHIENGK
GDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLVKHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFG
GFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLY
ILYTS
GTTG
LPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAI
RQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKS
VPGYNVMILDDNMQKLKARCLG
NIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMS
RVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLA
LCVLRKDINATEEQ
VLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA



DME EC Prediction for this protein is: 6.2.1.1
Check another protein