Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GGAERLV2.4.1;Hexosyltransferases. 27
  • Gene: ALG2
FYCHFPD2.4.1;Hexosyltransferases. 135
  • Gene: ALG2
LSINRYERKK2.4.1;Hexosyltransferases. 229
  • Gene: ALG2
EHFGIVPLEAM2.4.1;Hexosyltransferases. 325
  • Gene: ALG2

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAEEQGRERDSVPKPSVLFLHPDLGVGGAERLVLDAALALQARGCSVKIWTAHYDPGHCFAESRELPVRCAGDWLPRGLGWGGRGAAVCAYVRMVFLALY
VLFLADEEFDVVVCDQVSACIPVFRLARRRKKIL
FYCHFPDLLLTKRDSFLKRLYRAPIDWIEEYTTGMADCILVNSQFTAAVFKETFKSLSHIDPDVLY
PSLNVTSFDSVVPEKLDDLVPKGKKFLL
LSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFL
RSFSDKQKISLLHSCTCVLYTPSN
EHFGIVPLEAMYMQCPVIAVNSGGPLESIDHSVTGFLCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSP
EAFTEQLYRYVTKLLV



DME EC Prediction for this protein is: 2.4.1
Check another protein