Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
NFRFFASS1.2.1;With NAD(+) or NADP(+) as acceptor. 113
  • Gene: AL8A1
NQGEICLCTSRIFV1.2.1;With NAD(+) or NADP(+) as acceptor. 282
  • Active Site C=Cysteine at location 287 on the protein
  • Active Site Description: Nucleophile (By similarity).
  • Gene: AL8A1
EEIFGPVTCV1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 390 -
GLVWTNCWL1.2.1;With NAD(+) or NADP(+) as acceptor. 441
  • Gene: AL8A1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAGTNALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPSWSSRSPQERSRVLNQVADLLEQSLEEFAQAESKDQGKTLA
LARTMDIPRSVQ
NFRFFASSSLHHTSECTQMDHLGCMHYTVRAPVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPSELTSVTAWMLCKLLDKAGVP
PGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERITQLSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSFA
NQGEICLCTSRIFVQKSIY
SEFLKRFVEATRKWKVGIPSDPLVSIGALISKAHLEKVRSYVKRALAEGAQIWCGEGVDKLSLPARNQAGYFMLPTVITDIKDESCCMT
EEIFGPVTCVV
PFDSEEEVIERANNVKYGLAATVWSSNVGRVHRVAKKLQS
GLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEIKTITVKH



DME EC Prediction for this protein is: 1.2.1.3
Check another protein