Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
WLLLSLVAV3.4.17;Metallocarboxypeptidases. 6
  • Gene: ACE2
ASWNYNTNIT3.4.17;Metallocarboxypeptidases. 46
  • Gene: ACE2
MSTIYSTGK3.4.17;Metallocarboxypeptidases. 123
  • Gene: ACE2
NPQECLLLEPGL3.4.17;Metallocarboxypeptidases. 137
  • Gene: ACE2
DYGDYWRGDYE3.4.17;Metallocarboxypeptidases. 198
  • Gene: ACE2
YPSYISP3.4.17;Metallocarboxypeptidases. 252
  • Gene: ACE2
GCLPAHLLGDMWGRFWTNLY3.4.17;Metallocarboxypeptidases. 260
  • Binding Site R=Arginine at location 273 on the protein
  • Binding site description: Substrate (By similarity).
  • Gene: ACE2
QKPNIDVTDAM3.4.17;Metallocarboxypeptidases. 287
  • Gene: ACE2
VCHPTAWDLGKGDFRI3.4.17;Metallocarboxypeptidases. 343
  • Binding Site H=Histidine at location 345 on the protein
  • Binding site description: Substrate (By similarity).
  • Gene: ACE2
FLTAHHEMGHIQYDMAYA3.4.17;Metallocarboxypeptidases. 369
  • Active Site E=Glutamic acid at location 375 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 374 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
  • Binding Site T=Threonine at location 371 on the protein
  • Binding site description: Substrate (By similarity).
  • Gene: ACE2
LLRNGANEGFHEAVGEIMSLSAATP3.4.17;Metallocarboxypeptidases. 391
  • Metal Site E=Glutamic acid at location 402 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
  • Gene: ACE2
ETEINFLLKQALTIVGTLPFTYMLEKWRWMVF3.4.17;Metallocarboxypeptidases. 433
  • Gene: ACE2
KWWEMKR3.4.17;Metallocarboxypeptidases. 476
  • Binding Site W=Tryptophan at location 477 on the protein
  • Binding site description: Chloride (By similarity).
  • Gene: ACE2
PHDETYCDPA3.4.17;Metallocarboxypeptidases. 492
  • Gene: ACE2
PWTLALE3.4.17;Metallocarboxypeptidases. 565
  • Gene: ACE2
YFEPLFTWLK3.4.17;Metallocarboxypeptidases. 587
  • Gene: ACE2
DQSIKVRISLKSALG3.4.17;Metallocarboxypeptidases. 615
  • Gene: ACE2
SFNFFVT3.4.17;Metallocarboxypeptidases. 680
  • Gene: ACE2
DNSLEFLGI3.4.17;Metallocarboxypeptidases. 719
  • Gene: ACE2

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQAL
QQNGSSVLSEDKSKRLNTILNT
MSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYG
DYWRGDYE
VNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQ
AWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKA
VCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGF
HEAVGEIMSLSAATP
KHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDP
A
SLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNK
NSFVGWSTDWSPYA
DQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEV
EKAIRMSRSRINDAFRLN
DNSLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENPYASIDISKGENNPGFQNTDD
VQTSF



DME EC Prediction for this protein is: 3.4.17
Check another protein