Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
STDFEVHRNW2.4.1;Hexosyltransferases. 34
  • Gene: ALG8
VHRNWLAIT2.4.1;Hexosyltransferases. 39
  • Gene: ALG8
LPISQWY2.4.1;Hexosyltransferases. 50
  • Gene: ALG8
WTLDYPPFF2.4.1;Hexosyltransferases. 63
  • Gene: ALG8
DHIHFQYNG2.4.1;Hexosyltransferases. 159
  • Gene: ALG8
SRLFPFKRGL2.4.1;Hexosyltransferases. 267
  • Gene: ALG8
HAYWAPN2.4.1;Hexosyltransferases. 278
  • Gene: ALG8
FGWHVHEKAI2.4.1;Hexosyltransferases. 376
  • Gene: ALG8

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAALTIATGTGNWFSALALGVTLLKCLLIPTYHSTDFEVHRNWLAITHSLPISQWYYEATSEWTLDYPPFFAWFEYILSHVAKYFDQEMLNVHNLNYSSS
RTLLFQRFSVIFMDVLFVYAVRECCKCIDGKKVGKELTEKPKFILSVLLLWNFGLLIV
DHIHFQYNGFLFGLMLLSIARLFQKRHMEGAFLFAVLLHFKH
IYLYVAPAYGVYLLRSYCFTANKPDGSIRWKSFSFVRVISLGLVVFLVSALSLGPFLALNQLPQVF
SRLFPFKRGLCHAYWAPNFWALYNALDKVLSVIG
LKLKFLDPNNIPKASMTSGLVQQFQHTVLPSVTPLATLICTLIAILPSIFCLWFKPQGPRGFLRCLTLCALSSFM
FGWHVHEKAILLAILPMSLLSVGKA
GDASIFLILTTTGHYSLFPLLFTAPELPIKILLMLLFTIYSISSLKTLFRKEKPLFNWMETFYLLGLGPLEVCCEFVFPFTSWKVKYPFIPLLLTSVYCA
VGITYAWFKLYVSVLIDSAIGKTKKQ



DME EC Prediction for this protein is: 2.4.1
Check another protein