Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
IYYWYWRR3.1.1.23;Acylglycerol lipase. 37 -
VKFLPKNLHLVCVDMPGHEGT3.1.1.23;Acylglycerol lipase. 91 -
GQVKRIHQFVE3.1.1.23;Acylglycerol lipase. 123 -
LVCPAGLQYSTDN3.1.1.23;Acylglycerol lipase. 170
  • Gene: ABHD6
LQGLVDVRIPHN3.1.1.23;Acylglycerol lipase. 229 -
PTQIIWGKQDQVLDVSGA3.1.1.23;Acylglycerol lipase. 269
  • Active Site D=Aspartic acid at location 278 on the protein
  • Active Site Description: Charge relay system (By simila
LENCGHSVVMERPRK3.1.1.23;Acylglycerol lipase. 301
  • Active Site H=Histidine at location 306 on the protein
  • Active Site Description: Charge relay system (By simila

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHL
VCVDMPGHEGT
TRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKI
PLIPSTPEEMSEMLQLCSYVRFKVPQQI
LQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL
LENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD



DME EC Prediction for this protein is: 3.1.1.23
Check another protein