Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
MGTGTKCIGQ3.5.4;In cyclic amidines. 64
  • Domain: A to I editase
  • Gene: ADAT1
LNDSHAE3.5.4;In cyclic amidines. 83
  • Metal Site H=Histidine at location 87 on the protein
  • Metal Site Description: Zinc (By similarity).
  • Domain: A to I editase
SHTPCGDASIIP3.5.4;In cyclic amidines. 138
  • Metal Site C=Cysteine at location 142 on the protein
  • Metal Site Description: Zinc (By similarity).
  • Domain: A to I editase
  • Gene: ADAT1
VYRTGAK3.5.4;In cyclic amidines. 256
  • Domain: A to I editase
  • Gene: ADAT1
KPGRGDRT3.5.4;In cyclic amidines. 287
  • Domain: A to I editase
  • Gene: ADAT1
PIYLSAVV3.5.4;In cyclic amidines. 323
  • Domain: A to I editase
  • Gene: ADAT1
PLDVTANG3.5.4;In cyclic amidines. 407
  • Domain: A to I editase
  • Gene: ADAT1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MWTADEIAQLCYEHYGIRLPKKGKPEPNHEWTLLAAVVKIQSPADKACDTPDKPVQVTKEVVSMGTGTKCIGQSKMRKNGDILNDSHAEVIARRSFQRYL
LHQLQLAATLKEDSIFVPGTQKGVWKLRRDLIFVFFS
SHTPCGDASIIPMLEFEDQPCCPVFRNWAHNSSVEASSNLEAPGNERKCEDPDSPVTKKMRLE
PGTAAREVTNGAAHHQSFGKQKSGPISPGIHSCDLTVEGLATVTRIAPGSAKVID
VYRTGAKCVPGEAGDSGKPGAAFHQVGLLRVKPGRGDRTRSMSCS
DKMARWNVLGCQGALLMHLLEE
PIYLSAVVIGKCPYSQEAMQRALIGRCQNVSALPKGFGVQELKILQSDLLFEQSRSAVQAKRADSPGRLVPCGAAISW
SAVPEQ
PLDVTANGFPQGTTKKTIGSLQARSQISKVELFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQVFGSWIRNPPDYHQ
FK



DME EC Prediction for this protein is: 3.5.4
Check another protein