Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LCQRAKVAMSHFEP4.2.1.3;Aconitate hydratase. 26
  • Gene: ACON
RPLTLSEKI4.2.1.3;Aconitate hydratase. 61
  • Gene: ACON
YGHLDDP4.2.1.3;Aconitate hydratase. 71
  • Gene: ACON
PDRVAMQDA4.2.1.3;Aconitate hydratase. 93 -
QDATAQMA4.2.1.3;Aconitate hydratase. 99
  • Gene: ACON
GGEKDLRRAKDINQEVYNFLATAGAKYGVGFW4.2.1.3;Aconitate hydratase. 135
  • Gene: ACON
PGSGIIHQI4.2.1.3;Aconitate hydratase. 168 -
GTDSHTPN4.2.1.3;Aconitate hydratase. 190 -
GVGGADAVDVMAGIPWELK4.2.1.3;Aconitate hydratase. 207
  • Gene: ACON
VIGVKLTG4.2.1.3;Aconitate hydratase. 229
  • Gene: ACON
ILTVKGGTGAIVEY4.2.1.3;Aconitate hydratase. 254
  • Gene: ACON
GPGVDSIS4.2.1.3;Aconitate hydratase. 269
  • Gene: ACON
TICNMGAEIGATTS4.2.1.3;Aconitate hydratase. 282 -
NGPFTPDL4.2.1.3;Aconitate hydratase. 350 -
VAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAH4.2.1.3;Aconitate hydratase. 367
  • Metal Site C=Cysteine at location 385 on the protein
  • Metal Site Description: Iron-sulfur (4Fe-4S) (By simil
  • Gene: ACON
AAVAKQAL4.2.1;Hydro-lyases. 397 -
FTITPGSEQ4.2.1.3;Aconitate hydratase. 414
  • Gene: ACON
TPGSEQIRAT4.2.1.3;Aconitate hydratase. 417 -
RATIERDG4.2.1.3;Aconitate hydratase. 424 -
SYNRNFT4.2.1.3;Aconitate hydratase. 471
  • Gene: ACON
LEAPDADELP4.2.1.3;Aconitate hydratase. 524
  • Gene: ACON
RLQLLEPF4.2.1.3;Aconitate hydratase. 564 -
PFDKWDGKDLED4.2.1.3;Aconitate hydratase. 570
  • Gene: ACON
RGHLDNISNN4.2.1.3;Aconitate hydratase. 607
  • Gene: ACON
KANSVRNAVTQEFGPVPDTARYYK4.2.1.3;Aconitate hydratase. 628
  • Gene: ACON
WVVIGDEN4.2.1.3;Aconitate hydratase. 657
  • Gene: ACON
GEGSSREHAALEPR4.2.1.3;Aconitate hydratase. 666
  • Gene: ACON
GSSREHA4.2.1;Hydro-lyases. 668 -
KSFARIHETNLKKQG4.2.1.3;Aconitate hydratase. 689 -
EWFRAGSALN4.2.1.3;Aconitate hydratase. 764
  • Gene: ACON

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQD
ATAQMA
MLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGG
LGGICI
GVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYN
HRMKKYLSKTGREDIANLADEFKDHLVPDPGCHYDQLIEINLSELKPHI
NGPFTPDLAHPVAEVGKVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVA
KQALAH
GLKCKSQFTITPGSEQIRATIERDGYAQILRDLGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALA
IAGTLKFNPETDYLTGTDGKKFR
LEAPDADELPKGEFDPGQDTYQHPPKDSSGQHVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAA
GPWLKF
RGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLK
KQG
LLPLTFADPADYNKIHPVDKLTIQGLKDFTPGKPLKCIIKHPNGTQETILLNHTFNETQIEWFRAGSALNRMKELQQ



DME EC Prediction for this protein is: 4.2.1.3
Check another protein