Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KTWELSLYEL6.3.2;Acid--D-amino-acid ligases (peptide synthases). 15 -
VSPRSLHSELMCPICLDMLKNTMTTKECLHRFC6.3.2;Acid--D-amino-acid ligases (peptide synthases). 40 -
TALRSGNKECPTCRKKLVSKRSLRPDPNFDALIS6.3.2;Acid--D-amino-acid ligases (peptide synthases). 78 -
LISKIYPSR6.3.2;Acid--D-amino-acid ligases (peptide synthases). 109 -
KHNNQQALSHSIEEGLKIQAMNRLQRGKK6.3.2;Acid--D-amino-acid ligases (peptide synthases). 133
  • Gene: RING2
QIENGSGAEDNGDSSHCSNAS6.3.2;Acid--D-amino-acid ligases (peptide synthases). 163
  • Gene: RING2
HSNQEAGPS6.3.2;Acid--D-amino-acid ligases (peptide synthases). 185 -
KRTKTSDDSGL6.3.2;Acid--D-amino-acid ligases (peptide synthases). 195
  • Gene: RING2
EIELVFR6.3.2;Acid--D-amino-acid ligases (peptide synthases). 225 -
NATVDHLSKYLA6.3.2;Acid--D-amino-acid ligases (peptide synthases). 253 -
SEKQYTIYI6.3.2;Acid--D-amino-acid ligases (peptide synthases). 287 -
WKVNKPME6.3.2;Acid--D-amino-acid ligases (peptide synthases). 319 -
ELYYAPTKE6.3.2;Acid--D-amino-acid ligases (peptide synthases). 326 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSL
RPDPNFDALISKIYPSR
DEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTS
DDSGL
ELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASG
QFTVLNGSFSLELVSEKY
WKVNKPMELYYAPTKEHK



DME EC Prediction for this protein is: 6.3.2
Check another protein