Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
QRLFYRGKQ6.3.2;Acid--D-amino-acid ligases (peptide synthases). 43
  • Domain: Ubiquitin-like
WRFRVQVSE6.3.2;Acid--D-amino-acid ligases (peptide synthases). 430
  • Domain: YDG
GVHRPHV6.3.2;Acid--D-amino-acid ligases (peptide synthases). 440
  • Domain: YDG
GIHGRSNDGAYSLVLAGG6.3.2;Acid--D-amino-acid ligases (peptide synthases). 448
  • Domain: YDG
EGNRYDGIYKVVKYWPE6.3.2;Acid--D-amino-acid ligases (peptide synthases). 551
  • Domain: YDG
VWRYLLRRDD6.3.2;Acid--D-amino-acid ligases (peptide synthases). 575
  • Domain: YDG
HNVCKDCL6.3.2;Acid--D-amino-acid ligases (peptide synthases). 741 -
AQVFSCPACR6.3.2;Acid--D-amino-acid ligases (peptide synthases). 754 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQLLVRQSLVLPHSTKERDSELSDTDSGCCLG
QSESDKSSTHGEAAAETDSRPADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMN
SRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGP
SCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRNDASEVVLAGERLRESKKKAKMASATSSSQRDWGKG
MACVGRTKECTIVPSNHYGPIPGIPVGTM
WRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTGSGGRDLSGNKRTAEQSCDQK
LTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYAPA
EGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKK
LGLTMQYPEGYLEALANREREKENSKREEEEQQEGGFASPRTGKGKWKRKSAGGGPSRAGSPRRTSKKTKVEPYSLTAQQSSLIREDKSNAKLWNEVLAS
LKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQ
HNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR



DME EC Prediction for this protein is: 6.3.2
Check another protein