Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
AMYMDRGAEQLVEILNY4.6.1.1;Adenylate cyclase. 61
  • Domain: Guanylate cyclase
  • Gene: ADCYA
ISAIVEKVLIFGGDILKFAGDALLALW4.6.1.1;Adenylate cyclase. 79
  • Metal Site D=Aspartic acid at location 99 on the protein
  • Metal Site Description: Magnesium 1 (By similarity).
  • Domain: Guanylate cyclase
  • Gene: ADCYA
GYLSELRPVTIVFVNLMF4.6.1.1;Adenylate cyclase. 284
  • Gene: ADCYA
GQINKVFMFDKGCSFLCVFGFPGEK4.6.1.1;Adenylate cyclase. 330
  • Domain: Guanylate cyclase
  • Gene: ADCYA
DIFDFCSQVHKI4.6.1.1;Adenylate cyclase. 368
  • Domain: Guanylate cyclase
  • Gene: ADCYA
TVSIGVASGIVFCGIVGHTVRHEYTVIGQKVN4.6.1.1;Adenylate cyclase. 381
  • Domain: Guanylate cyclase
  • Gene: ADCYA
YFFKELPKK4.6.1.1;Adenylate cyclase. 440
  • Gene: ADCYA
EKVMFGMA4.6.1.1;Adenylate cyclase. 467
  • Gene: ADCYA
MANVLGLDTCKHYKERQTNL4.6.1.1;Adenylate cyclase. 561
  • Gene: ADCYA
LSHQMLVRCAAIIGLTFTTELLFEILPCWNMKMMIK4.6.1.1;Adenylate cyclase. 824
  • Gene: ADCYA
SRYMEGQVL4.6.1.1;Adenylate cyclase. 1464
  • Gene: ADCYA
LVAQNTTGPVF4.6.1.1;Adenylate cyclase. 1499
  • Gene: ADCYA

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MNTPKEEFQDWPIVRIAAHLPDLIVYGHFSPERPFMDYFDGVLMFVDISGFTAMTEKFSSAMYMDRGAEQLVEILNYHISAIVEKVLIFGGDILKFAGDA
LLALW
RVERKQLKNIITVVIKCSLEIHGLFETQEWEEGLDIRVKIGLAAGHISMLVFGDETHSHFLVIGQAVDDVRLAQNMAQMNDVILSPNCWQLCDRS
MIEIESVPDQRAVKVNFLKPPPNFNFDEFFTKCTTFMHYYPSGEHKNLLRLACTLKPDPELEMSLQKYVMESILKQIDNKQLQ
GYLSELRPVTIVFVNLM
F
EDQDKAEEIGPAIQDAYMHITSVLKIFQGQINKVFMFDKGCSFLCVFGFPGEKVPDELTHALECAMDIFDFCSQVHKIQTVSIGVASGIVFCGIVGHTV
RHEYTVIGQKVN
LAARMMMYYPGIVTCDSVTYNGSNLPAYFFKELPKKVMKGVADSGPLYQYWGRTEKVMFGMACLICNRKEDYPLLGRNKEINYFMYTM
KKFLISNSSQVLMYEGLPGYGKSQILMKIEYLAQGKNHRIIAISLNKISFHQTFYTIQMF
MANVLGLDTCKHYKERQTNLRNKVMTLLDEKFYCLLNDIF
HVQFPISREISRMSTLKKQKQLEILFMKILKLIVKEERIIFIIDEAQFVDSTSWRFMEKLIRTLPIFIIMSLCPFVNIPCAAARAVIKNRNTTYIVIGAV
QPNDISNKICLDLNVSCISKELDSYLGEGSCGIPFYCEELLKNLEHHEVLVFQQTESEEKTNRTWNNLFKYSIKLTEKLNMVTLHSDKESEEVCHLTSGV
RLKNLSPPTSLKEISLIQLDSMR
LSHQMLVRCAAIIGLTFTTELLFEILPCWNMKMMIKTLATLVESNIFYCFRNGKELQKALKQNDPSFEVHYRSLSLK
PSEGMDHGEEEQLRELENEVIECHRIRFCNPMMQKTAYELWLKDQRKAMHLKCARFLEEDAHRCDHCRGRDFIPYHHFTVNIRLNALDMDAIKKMAMSHG
FKTEEKLILSNSEIPETSAFFPENRSPEEIREKILNFFDHVLTKMKTSDEDIIPLESCQCEEILEIVILPLAHHFLALGENDKALYYFLEIASAYLIFCD
NYMAYMYLNEGQKLLKTLKKDKSWSQTFESATFYSLKGEVCFNMGQIVLAKKMLRKALKLLNRIFPYNLISLFLHIHVEKNRHFHYVNRQAQESPPPGKK
RLAQLYRQTVCLSLLWRIYSYSYLFHCKYYAHLAVMMQMNTALETQNCFQIIKAYLDYSLYHHLAGYKGVWFKYEVMAMEHIFNLPLKGEGIEIVAYVAE
TLVFNKLIMGHLDLAIELGSRALQMWALLQNPNRHYQSLCRLSRCLLLNSRYPQLIQVLGRLWELSVTQEHIFSKAFFYFVCLDILLYSGFVYRTFEECL
EFIHQYENNRILKFHSGLLLGLYSSVAIWYARLQEWDNFYKFSNRAKNLLPRRTMTLTYYDGI
SRYMEGQVLHLQKQIKEQSENAQASGEELLKNLENLV
AQNTTGPVF
CPRLYHLMAYVCILMGDGQKCGLFLNTALRLSETQGNILEKCWLNMNKESWYSTSELKEDQWLQTILSLPSWEKIVAGRVNIQDLQKNKFL
MRANTVDNHF



DME EC Prediction for this protein is: 4.6.1.1
Check another protein