Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RAGTTLVECKSGYGL3.5.2.7;Imidazolonepropionase. 147
  • Binding Site Y=Tyrosine at location 159 on the protein
  • Binding site description: Substrate (By similarity).
  • Gene: HUTI
KSGYGLD3.5.2.7;Imidazolonepropionase. 156
  • Binding Site Y=Tyrosine at location 159 on the protein
  • Binding site description: Substrate (By similarity).
  • Gene: HUTI
MLRVIER3.5.2.7;Imidazolonepropionase. 169
  • Gene: HUTI
TYCGAHSVPKGK3.5.2.7;Imidazolonepropionase. 187
  • Binding Site H=Histidine at location 192 on the protein
  • Binding site description: Substrate (By similarity).
  • Gene: HUTI
INFHGDELHP3.5.2.7;Imidazolonepropionase. 257
  • Metal Site H=Histidine at location 260 on the protein
  • Metal Site Description: Zinc or iron (By similarity).
  • Binding Site E=Glutamic acid at location 263 on the protein
  • Binding site description: Substrate (By similarity).
  • Gene: HUTI
LRLKQPRAR3.5.2.7;Imidazolonepropionase. 312
  • Gene: HUTI
LGSDFNPNAYCFSMPMVMHLACVNM3.5.2.7;Imidazolonepropionase. 331
  • Metal Site D=Aspartic acid at location 334 on the protein
  • Metal Site Description: Zinc or iron (By similarity).
  • Gene: HUTI
HGSLEVGK3.5.2.7;Imidazolonepropionase. 380
  • Gene: HUTI
RWEHLIYQ3.5.2.7;Imidazolonepropionase. 398
  • Gene: HUTI

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MASGHSLLLENAQQVVLVCARGERFLARDALRSLAVLEGASLVVGKDGFIKAIGPADVIQRQFSGETFEEIIDCSGKCILPGLVDAHTHPVWAGERVHEF
AMKLAGATYMEIHQAGGGIHFTVERTRQATEEELFRSLQQRLQCMM
RAGTTLVECKSGYGLDLETELKMLRVIERARRELDIGISATYCGAHSVPKGKTA
TEAADDIINNHLPKLKELGRNGEIHVDNIDVFCEKGVFDLDSTRRILQRGKDIGLQ
INFHGDELHPMKAAELGAELGAQAISHLEEVSDEGIVAMATARC
SAILLPTTAYM
LRLKQPRARKMLDEGVIVALGSDFNPNAYCFSMPMVMHLACVNMRMSMPEALAAATINAAYALGKSHTHGSLEVGKQGDLIIINSSRWE
HLIYQ
FGGHHELIEYVIAKGKLIYKT



DME EC Prediction for this protein is: 3.5.2.7
Check another protein