Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
AIDAGYRH1.1.1;With NAD(+) or NADP(+) as acceptor. 26 -
KLWCTCHKKSLV1.1.1.263;1 5-anhydro-D-fructose reductase. 69
  • Gene: AKCL2
YLDLYLIHWPMGFKP1.1.1.263;1 5-anhydro-D-fructose reductase. 95
  • Binding Site H=Histidine at location 102 on the protein
  • Binding site description: Substrate (By similarity).
  • Gene: AKCL2
NQIECHPYL1.1.1;With NAD(+) or NADP(+) as acceptor. 193 -
VSVTAYRPLGGS1.1.1.263;1 5-anhydro-D-fructose reductase. 215
  • Gene: AKCL2
NIQVFDF1.1.1;With NAD(+) or NADP(+) as acceptor. 277 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLVETACRKSLKALKLNYLDLYL
IHWPMGFKP
PHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPY
L
TQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLNRNL
RLAMFPITKNHKDYPFHIEY



DME EC Prediction for this protein is: 1.1.1.263
Check another protein