Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GRRSLSRSISQSSTDSYSSAASYTDSSDDE3.3.1.1;Adenosylhomocysteinase. 140 -
FGRREIEIAE3.3.1.1;Adenosylhomocysteinase. 196 -
LRKRAQGEKPLAGAKIVGCTHITAQTAVL3.3.1.1;Adenosylhomocysteinase. 214
  • Binding Site T=Threonine at location 236 on the protein
  • Binding site description: Substrate (By similarity).
ALGAQCRW3.3.1.1;Adenosylhomocysteinase. 248 -
ACNIYST3.3.1.1;Adenosylhomocysteinase. 257 -
VFAWKGE3.3.1.1;Adenosylhomocysteinase. 278 -
NMILDDGGD3.3.1.1;Adenosylhomocysteinase. 305
  • Binding Site D=Aspartic acid at location 310 on the protein
  • Binding site description: Substrate (By similarity).
LDDGGDLT3.3.1.1;Adenosylhomocysteinase. 308
  • Binding Site D=Aspartic acid at location 310 on the protein
  • Binding site description: Substrate (By similarity).
GIVEESVTGVHRLY3.3.1.1;Adenosylhomocysteinase. 331
  • Binding Site E=Glutamic acid at location 335 on the protein
  • Binding site description: Substrate (By similarity).
NVNDSVTK3.3.1.1;Adenosylhomocysteinase. 358 -
MFGGKQVVVCGYGEVGKGCCAALKA3.3.1.1;Adenosylhomocysteinase. 389 -
EIDPICA3.3.1.1;Adenosylhomocysteinase. 422 -
DPICALQA3.3.1.1;Adenosylhomocysteinase. 424 -
QACMDGF3.3.1.1;Adenosylhomocysteinase. 430 -
VKLNEVIRQVD3.3.1.1;Adenosylhomocysteinase. 439 -
TPELTWERVRSQVDH3.3.1.1;Adenosylhomocysteinase. 492 -
TQALALIEL3.3.1.1;Adenosylhomocysteinase. 542 -
DVYLLPKKMDEYVASLHL3.3.1.1;Adenosylhomocysteinase. 561 -
LTELTDEQ3.3.1.1;Adenosylhomocysteinase. 585 -
QAKYLGL3.3.1.1;Adenosylhomocysteinase. 592 -
KNGPFKPN3.3.1.1;Adenosylhomocysteinase. 600 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSVQVVSAAAAAKVPEVELKDLSPSEAESQLGLSTAAVGAMAPPAGGGDPEAPAPAAERPPVPGPGSGPAAALSPAAGKVPQASAMKRSDPHHQHQRHRD
GGEALVSPDGTVTEAPRTVKKQIQFADQKQEFNKRPTKI
GRRSLSRSISQSSTDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRRE
IEIAE
QEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVE
GWQP
NMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGY
GEVGKGCCAALKA
MGSIVYVTEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERV
RSQVDH
VIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNK
NGPFKPN
YYRY



DME EC Prediction for this protein is: 3.3.1.1
Check another protein