Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GGTHGNE3.5.1.15;Aspartoacylase. 18
  • Metal Site H=Histidine at location 21 on the protein
  • Metal Site Description: Zinc (By similarity).
GPQPQGV3.5.1.15;Aspartoacylase. 180 -
LDFIELFN3.5.1.15;Aspartoacylase. 203 -
FINEAAY3.5.1.15;Aspartoacylase. 282 -
NEAAYYEK3.5.1.15;Aspartoacylase. 284
  • Binding Site Y=Tyrosine at location 288 on the protein
  • Binding site description: Substrate (By similarity).

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MCSLPVPREPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSGCRRYVDHDLNRTFTSSFLNSRPTPDDPYEVTRARELNQLL
GPKASGQAFDFVLDLHNTTANMGTCLIAKSSHEVFAMHLCRHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGLGLEL
GPQPQGVLRADIFSRMRTLVA
TV
LDFIELFNQGTAFPAFEMEAYRPVGVVDFPRTEAGHLAGTVHPQLQDRDFQPLQPGAPIFQMFSGEDLLYEGESTVYPVFINEAAYYEKGVAFVQTEK
FTFTVPAMPALTPAPSPAS



DME EC Prediction for this protein is: 3.5.1.15
Check another protein