Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
EEALWTTRADGRVRLR6.2.1.3;Long-chain-fatty-acid--CoA ligase. 78
  • Gene: ACBG1
FNSPEWFFSAVG6.2.1.3;Long-chain-fatty-acid--CoA ligase. 165
  • Gene: ACBG1
VDTQKQLEKILK6.2.1.3;Long-chain-fatty-acid--CoA ligase. 210
  • Gene: ACBG1
LPHLKAVVIY6.2.1.3;Long-chain-fatty-acid--CoA ligase. 226
  • Gene: ACBG1
VPRVWEK6.2.1.3;Long-chain-fatty-acid--CoA ligase. 375 -
IQEVAAQSGFI6.2.1.3;Long-chain-fatty-acid--CoA ligase. 386
  • Gene: ACBG1
RLADYLVLA6.2.1.3;Long-chain-fatty-acid--CoA ligase. 426
  • Gene: ACBG1
FFLGLNIRLYAGYGLSE6.2.1.3;Long-chain-fatty-acid--CoA ligase. 462
  • Gene: ACBG1
GIGEICLWGRTIFMGYLNMEDKT6.2.1.3;Long-chain-fatty-acid--CoA ligase. 514
  • Gene: ACBG1
KELIITAGGENVPPVPIE6.2.1.3;Long-chain-fatty-acid--CoA ligase. 567 -
NAAARPYHIQKWAIL6.2.1.3;Long-chain-fatty-acid--CoA ligase. 671
  • Gene: ACBG1
GGELGPTMKLKR6.2.1.3;Long-chain-fatty-acid--CoA ligase. 693
  • Binding Site K=Lysine at location 701 on the protein
  • Binding site description: ATP (By similarity).
IDSFYQEQK6.2.1.3;Long-chain-fatty-acid--CoA ligase. 715
  • Gene: ACBG1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MPRNSGAGYGCPHGDPSMLDSRETPQESRQDMIVRTTQEKLKTSSLTDRQPLSKESLNHALELSVPEKVNNAQWDAPEEALWTTRADGRVRLRIDPSCPQ
LPYTVHRMFYEALDKYGDLIALGFKRQDKWEHISYSQYYLLARRAAKGFLKLGLKQAHSVAILG
FNSPEWFFSAVGTVFAGGIVTGIYTTSSPEACQYIA
YDCCANVIM
VDTQKQLEKILKIWKQLPHLKAVVIYKEPPPNKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLVYTSGTTGNPKGVMLSQDNIT
WTARYGSQAGDIRPAEVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCFAEPDALKGSLVNTLREVEPTSHMG
VPRVWEKIMERIQEVAAQSGFIRRKM
LLWAMSVTLEQNLTCPGSDLKPFTT
RLADYLVLAKVRQALGFAKCQKNFYGAAPMMAETQHFFLGLNIRLYAGYGLSETSGPHFMSSPYNYRLYSSGKLV
PGCRVKLVNQDAE
GIGEICLWGRTIFMGYLNMEDKTCEAIDEEGWLHTGDAGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISNAMLI
GDQRKFLSMLLTLKCTLDPDTSDQTDNLTEQAMEFCQRVGSRATTVSEIIEKKDEAVYQAIEEGIRRVNM
NAAARPYHIQKWAILERDFSISGGELGPTM
KLKR
LTVLEKYKGIIDSFYQEQKM



DME EC Prediction for this protein is: 6.2.1.3
Check another protein