Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GDRLGMWGPN6.2.1;Acid--thiol ligases. 124
  • Gene: ACSF2
VFPKQFKTQQYY6.2.1;Acid--thiol ligases. 176
  • Gene: ACSF2
DPINIQFTSGTTG6.2.1;Acid--thiol ligases. 256
  • Gene: ACSF2
PKGATLSH6.2.1;Acid--thiol ligases. 270
  • Gene: ACSF2
PLYHCLGSV6.2.1;Acid--thiol ligases. 308
  • Gene: ACSF2
FNGKKALEAISRE6.2.1;Acid--thiol ligases. 336
  • Gene: ACSF2
APPELIRAII6.2.1;Acid--thiol ligases. 387
  • Gene: ACSF2
ENSPVTF6.2.1;Acid--thiol ligases. 412
  • Gene: ACSF2
EDTVEQKAESVGR6.2.1;Acid--thiol ligases. 423
  • Gene: ACSF2
SVGRIMPHTEA6.2.1;Acid--thiol ligases. 432
  • Gene: ACSF2
IRGYCVM6.2.1;Acid--thiol ligases. 463
  • Gene: ACSF2
GGENIYPA6.2.1.26;o-succinylbenzoate--CoA ligase. 516 -
RMGEEICACIRLK6.2.1;Acid--thiol ligases. 547
  • Gene: ACSF2

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAVYVGMLRLGRLCAGSSGVLGARAALSRSWQEARLQGVRFLSSREVDRMVSTPIGGLSYVQGCTKKHLNSKTVGQCLETTAQRVPEREALVVLHEDVRL
TFAQLKEEVDKAASGLLSIGLCK
GDRLGMWGPNSYAWVLMQLATAQAGIILVSVNPAYQAMELEYVLKKVGCKALVFPKQFKTQQYYNVLKQICPEVENA
QPGALKSQRLPDLTTVISVDAPLPGTLLLDEVVAAGSTRQHLDQLQYNQQFLSCH
DPINIQFTSGTTGSPKGATLSHYNIVNNSNILGERLKLHEKTPEQ
LRMILPN
PLYHCLGSVAGTMMCLMYGATLILASPIFNGKKALEAISRERGTFLYGTPTMFVDILNQPDFSSYDISTMCGGVIAGSPAPPELIRAIINKIN
MKDLVVAYGTT
ENSPVTFAHFPEDTVEQKAESVGRIMPHTEARIMNMEAGTLAKLNTPGELCIRGYCVMLGYWGEPQKTEEAVDQDKWYWTGDVATMNEQ
GFCKIVGRSKDMIIR
GGENIYPAELEDFFHTHPKVQEVQVVGVKDDRMGEEICACIRLKDGEETTVEEIKAFCKGKISHFKIPKYIVFVTNYPLTISGKI
QKFKLREQMERHLNL



DME EC Prediction for this protein is: 6.2.1.26
Check another protein