Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LYAEQLSG1.13.11.5;Homogentisate 1 2-dioxygenase. 39
  • Gene: HGD
PNEICVI1.13.11.5;Homogentisate 1 2-dioxygenase. 176
  • Gene: HGD
EICVIQRG1.13.11.5;Homogentisate 1 2-dioxygenase. 178
  • Gene: HGD
LGPIGANGLA1.13.11.5;Homogentisate 1 2-dioxygenase. 213
  • Gene: HGD
VVAWHGN1.13.11.5;Homogentisate 1 2-dioxygenase. 265
  • Gene: HGD
DPSIFTVLT1.13.11.5;Homogentisate 1 2-dioxygenase. 294
  • Gene: HGD
DFVIFPPRW1.13.11.5;Homogentisate 1 2-dioxygenase. 314
  • Gene: HGD
TFRPPYYHRNCMSE1.13.11.5;Homogentisate 1 2-dioxygenase. 328
  • Metal Site H=Histidine at location 335 on the protein
  • Metal Site Description: Iron (By similarity).
  • Gene: HGD
MSEFMGLI1.13.11.5;Homogentisate 1 2-dioxygenase. 339
  • Metal Site E=Glutamic acid at location 341 on the protein
  • Metal Site Description: Iron (By similarity).
  • Gene: HGD
TMAFMFE1.13.11.5;Homogentisate 1 2-dioxygenase. 395
  • Gene: HGD
AFMFESSLSLAVTKWG1.13.11.5;Homogentisate 1 2-dioxygenase. 397
  • Gene: HGD

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGQVTHNWDEVDPDPNQLRWKPF
EIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQ
PNEICVIQRGMRFSIDVFEETRGYI
LEVYGVHFELPD
LGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTV
LT
AKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHYEAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMF
ESSLSLAVTKWG
LKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN



DME EC Prediction for this protein is: 1.13.11.5
Check another protein