Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
TGPLVYP2.4.1.130;Dolichyl-phosphate-mannose--glycolipid alpha-mannosyltransferase. 95
  • Gene: ALG3
VLRLFND2.4.1.130;Dolichyl-phosphate-mannose--glycolipid alpha-mannosyltransferase. 169
  • Gene: ALG3
WTVNWRF2.4.1.130;Dolichyl-phosphate-mannose--glycolipid alpha-mannosyltransferase. 272
  • Gene: ALG3
RSLHYQF2.4.1.130;Dolichyl-phosphate-mannose--glycolipid alpha-mannosyltransferase. 354
  • Gene: ALG3

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAAGLRKRGRSGSAAQAEGLCKQWLQRAWQERRLLLREPRYTLLVAACLCLAEVGITFWVIHRVAYTEIDWKAYMAEVEGVINGTYDYTQLQGDTGPLVY
P
AGFVYIFMGLYYATSRGTDIRMAQNIFAVLYLATLLLVFLIYHQTCKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMVLLFLSINLLLAQRWGWGCCF
FSLAVSVKMNVLLFAPGLLFLLLTQFGFRGALPKLGICAGLQVVLGLPFLLENPSGYLSRSFDLGRQFLFH
WTVNWRFLPEALFLHRAFHLALLTAHLTL
LLLFALCRWHRTGESILSLLRDPSKRKVPPQPLTPNQIVSTLFTSNFIGICFS
RSLHYQFYVWYFHTLPYLLWAMPARWLTHLLRLLVLGLIELSWNTYP
STSCSSAALHICHAVILLQLWLGPQPFPKSTQHSKKAH



DME EC Prediction for this protein is: 2.4.1.130
Check another protein