Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
VLYDKYIRPE3.1.13.1;Exoribonuclease II. 141
  • Domain: Exonuclease
HSSVEDA3.1.13.1;Exoribonuclease II. 253
  • Domain: Exonuclease

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MVPREAPESAQCLCPSLTIPNAKDVLRKRHKRRSRQHQRFMARKALLQEQGLLSMPPEPGSSPLPTPFGAATATEAASSGKQCLRAGSGSAPCSRRPAPG
KASGPLPSKCVAIDCEMVGTGPRGRVSELARCSIVSYHGN
VLYDKYIRPEMPIADYRTRWSGITRQHMRKAVPFQVAQKEILKLLKGKVVVGHALHNDFQ
ALKYVHPRSQTRDTTYVPNFLSEPGLHTRARVSLKDLALQLLHKKIQVGQHG
HSSVEDATTAMELYRLVEVQWEQQEARSLWTCPEDREPDSSTDMEQYM
EDQYWPDDLAHGSRGGAREAQDRRN



DME EC Prediction for this protein is: 3.1.13.1
Check another protein