Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
VETLVVAD3.4.24.82;ADAMTS-4 endopeptidase. 220
  • Domain: Peptidase M12B
DTAILFTRQ3.4.24.82;ADAMTS-4 endopeptidase. 311
  • Domain: Peptidase M12B
CDTLGMADVGT3.4.24.82;ADAMTS-4 endopeptidase. 327
  • Domain: Peptidase M12B
GTMCDPK3.4.24;Metalloendopeptidases. 336
  • Domain: Peptidase M12B
SCSVIED3.4.24;Metalloendopeptidases. 344
  • Domain: Peptidase M12B
VIEDDGL3.4.24;Metalloendopeptidases. 347
  • Domain: Peptidase M12B
AHELGHVF3.4.24.82;ADAMTS-4 endopeptidase. 360
  • Active Site E=Glutamic acid at location 362 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 361 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
  • Domain: Peptidase M12B
HFPWADGTSCGEGK3.4.24;Metalloendopeptidases. 484
  • Domain: Disintegrin
CSRTCGGGV3.4.24.82;ADAMTS-4 endopeptidase. 528
  • Domain: TSP type-1
DKCGVCGG3.4.24.14;Procollagen N-endopeptidase. 670 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MLLLGILTLAFAGRTAGGSEPEREVVVPIRLDPDINGRRYYWRGPEDSGDQGLIFQITAFQEDFYLHLTPDAQFLAPAFSTEHLGVPLQGLTGGSSDLRR
CFYSGDVNAEPDSFAAVSLCGGLRGAFGYRGAEYVISPLPNASAPAAQRNSQGAHLLQRRGVPGGPSGDPTSRCGVASGWNPAILRALDPYKPRRAGFGE
SRSRRRSGRAKRFVSIPRY
VETLVVADESMVKFHGADLEHYLLTLLATAARLYRHPSILNPINIVVVKVLLLRDRDSGPKVTGNAALTLRNFCAWQKKLN
KVSDKHPEYW
DTAILFTRQDLCGATTCDTLGMADVGTMCDPKRSCSVIEDDGLPSAFTTAHELGHVFNMPHDNVKVCEEVFGKLRANHMMSPTLIQIDRA
NPWSACSAAIITDFLDSGHGDCLLDQPSKPISLPEDLPGASYTLSQQCELAFGVGSKPCPYMQYCTKLWCTGKAKGQMVCQTR
HFPWADGTSCGEGKLCL
KGACVERHNLNKHRVDGSWAKWDPYGP
CSRTCGGGVQLARRQCTNPTPANGGKYCEGVRVKYRSCNLEPCPSSASGKSFREEQCEAFNGYNHSTNRLTLA
VAWVPKYSGVSPRDKCKLICRANGTGYFYVLAPKVVDGTLCSPDSTSVCVQGKCIKAGCDGNLGSKKRF
DKCGVCGGDNKSCKKVTGLFTKPMHGYNFVV
AIPAGASSIDIRQRGYKGLIGDDNYLALKNSQGKYLLNGHFVVSAVERDLVVKGSLLRYSGTGTAVESLQASRPILEPLTVEVLSVGKMTPPRVRYSFYL
PKEPREDKSSHPKDPRGPSVLHNSVLSLSNQVEQPDDRPPARWVAGSWGPCSASCGSGLQKRAVDCRGSAGQRTVPACDAAHRPVETQACGEPCPTWELS
AWSPCSKSCGRGFQRRSLKCVGHGGRLLARDQCNLHRKPQELDFCVLRPC



DME EC Prediction for this protein is: 3.4.24.82
Check another protein