Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
NNFHSLYVKRHQ4.6.1.1;Adenylate cyclase. 259 -
ADIVGFT4.6.1.1;Adenylate cyclase. 277
  • Metal Site D=Aspartic acid at location 278 on the protein
  • Metal Site Description: Magnesium 1 (By similarity).
  • Domain: Guanylate cyclase
LNELFGKFD4.6.1.1;Adenylate cyclase. 298 -
RIKILGDCYYC4.6.1.1;Adenylate cyclase. 316
  • Metal Site D=Aspartic acid at location 322 on the protein
  • Metal Site Description: Magnesium 1 (By similarity).
  • Domain: Guanylate cyclase
ATGVDINMRVG4.6.1.1;Adenylate cyclase. 358 -
WQYDVWS4.6.1.1;Adenylate cyclase. 384 -
DVTLANHME4.6.1.1;Adenylate cyclase. 392
  • Domain: Guanylate cyclase
TRYLESWGAA4.6.1.1;Adenylate cyclase. 479 -
RLDFLWK4.6.1.1;Adenylate cyclase. 815 -
ECLRLLNEII4.6.1.1;Adenylate cyclase. 897
  • Domain: Guanylate cyclase
EKIKTIG4.6.1.1;Adenylate cyclase. 922
  • Domain: Guanylate cyclase
TVNVASR4.6.1.1;Adenylate cyclase. 1010
  • Domain: Guanylate cyclase
ASRMEST4.6.1;Lyases Phosphorus-oxygen lyases 1014
  • Domain: Guanylate cyclase
KIQVTEET4.6.1.1;Adenylate cyclase. 1025 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLAVAWASGRELTSDPSFLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWVAL
LALGHAFLFTGGVVSAWDQVSYFLFVIFTAYAMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVLFLCGNVAGVYHKALMERALR
ATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMKAEIMARLQAGQGSRPEST
NNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFD
QIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATGVDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHME
AGGVPGRVHITGATLALLAGAYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGLKMRPSLLMTRYLESWGAAKPFAHLSHGDSP
VSTSTPLPEKTLASFSTQWSLDRSRTPRGLDDELDTGDAKFFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFI
IQMLVTNRPPALAITYSITFLLFLLILFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRPGLRIALGTATILLVFAMAITSLFFFPTSSDCPFQAPNVSS
MISNLSWELPGSLPLISVPYSMHCCTLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSECLIVRLYLGPLDSRPGVLKEPKLMGAISFFIFF
FTLLVLARQNEYYC
RLDFLWKKKLRQEREETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEII
ADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMVEFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQ
KPQYDIWGN
TVNVASRMESTGVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSATLG



DME EC Prediction for this protein is: 4.6.1.1
Check another protein