Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
TLKDLIYD2.7.11.30;Receptor protein serine/threonine kinase. 166
  • Domain: GS
SGSGSGLP2.7.11.30;Receptor protein serine/threonine kinase. 177
  • Domain: GS
PLLVQRTIA2.7.11.30;Receptor protein serine/threonine kinase. 184
  • Domain: GS
ARTIVLQE2.7.11.30;Receptor protein serine/threonine kinase. 192
  • Domain: GS
VAVKIFSSR2.7.11.30;Receptor protein serine/threonine kinase. 219
  • Binding Site K=Lysine at location 222 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
RHENILGFIAAD2.7.11.30;Receptor protein serine/threonine kinase. 245
  • Domain: Protein kinase
GMIKLALS2.7.11.30;Receptor protein serine/threonine kinase. 291
  • Domain: Protein kinase
ASGLAHLH2.7.11.30;Receptor protein serine/threonine kinase. 300
  • Domain: Protein kinase
KPAIAHRD2.7.11.30;Receptor protein serine/threonine kinase. 316
  • Domain: Protein kinase
HRDIKSKN2.7.11;Protein-serine/threonine kinases. 321
  • Active Site D=Aspartic acid at location 323 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
IADLGLA2.7.11;Protein-serine/threonine kinases. 339
  • Domain: Protein kinase
FESFKRADIY2.7.11.30;Receptor protein serine/threonine kinase. 383
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MTRALCSALRQALLLLAAAAELSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLP
TASPNAPKLGPMELAIIITVPVCLLSIAAMLTVWACQGRQCSYRKKKRPNVEEPLSECNLVNAGK
TLKDLIYDVTASGSGSGLPLLVQRTIARTIVLQEI
VGKGRFGEVWHGRWCGED
VAVKIFSSRDERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSEYHEQGSLYDYLNRNIVTVAGMIKLALSIA
SGLAHLH
MEIVGTQGKPAIAHRDIKSKNILVKKCETCAIADLGLAVKHDSILNTIDIPQNPKVGTKRYMAPEMLDDTMNVNIFESFKRADIYSVGLVYWE
IARRCSVGGIVEEYQLPYYDMVPSDPSIEEMRKVVCDQKFRPSIPNQWQSCEALRVMGRIMRECWYANGAARLTALRIKKTISQLCVKEDCKA



DME EC Prediction for this protein is: 2.7.11.30
Check another protein