Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
WWPLPLLLLLL3.4.21;Serine endopeptidases. 10
  • Gene: PCSK9
DYEELVLALRSEE3.4.21;Serine endopeptidases. 37
  • Gene: PCSK9
WRLPGTY3.4.21;Serine endopeptidases. 72
  • Gene: PCSK9
SQSERTARRLQAQAA3.4.21;Serine endopeptidases. 89
  • Gene: PCSK9
ERTARRLQAQAARRGYL3.4.21;Serine endopeptidases. 92
  • Gene: PCSK9
RGYLTKILHVFH3.4.21;Serine endopeptidases. 105
  • Gene: PCSK9
PGFLVKMS3.4.21;Serine endopeptidases. 120
  • Gene: PCSK9
LALKLPHV3.4.21;Serine endopeptidases. 133
  • Gene: PCSK9
LPHVDYIEEDS3.4.21;Serine endopeptidases. 137
  • Gene: PCSK9
VFAQSIPWNLERI3.4.21;Serine endopeptidases. 149
  • Gene: PCSK9
ADEYQPP3.4.21;Serine endopeptidases. 168
  • Domain: Peptidase S8
  • Gene: PCSK9
VEVYLLDTSIQ3.4.21;Serine endopeptidases. 180
  • Active Site D=Aspartic acid at location 186 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S8
  • Gene: PCSK9
HREIEGRV3.4.21;Serine endopeptidases. 193
  • Domain: Peptidase S8
  • Gene: PCSK9
VLNCQGKGTVS3.4.21;Serine endopeptidases. 252
  • Domain: Peptidase S8
  • Gene: PCSK9
GPLVVLLPLAGGYSR3.4.21;Serine endopeptidases. 281
  • Domain: Peptidase S8
  • Gene: PCSK9
YSPASAP3.4.21;Serine endopeptidases. 325
  • Domain: Peptidase S8
CVDLFAPG3.4.21.111;Aqualysin 1. 358
  • Domain: Peptidase S8
DIIGASSDCSTC3.4.21;Serine endopeptidases. 367
  • Domain: Peptidase S8
  • Gene: PCSK9
SGTSQAAAHVAGI3.4.21;Serine endopeptidases. 383
  • Active Site S=Serine at location 386 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S8
  • Gene: PCSK9
LTLAELRQRLI3.4.21;Serine endopeptidases. 406
  • Domain: Peptidase S8
  • Gene: PCSK9
AWFPEDQ3.4.21;Serine endopeptidases. 427
  • Domain: Peptidase S8
  • Gene: PCSK9
VLTPNLVA3.4.21;Serine endopeptidases. 435
  • Gene: PCSK9
CRTVWSAHSGPTR3.4.21;Serine endopeptidases. 457
  • Gene: PCSK9
AHNAFGG3.4.21;Serine endopeptidases. 511
  • Gene: PCSK9
MGTRVHCH3.4.21;Serine endopeptidases. 546
  • Gene: PCSK9
HVLTGCS3.4.21;Serine endopeptidases. 557
  • Gene: PCSK9
LRPRGQPNQCVGHREASIHASCC3.4.21;Serine endopeptidases. 579
  • Gene: PCSK9
APGLECKVKEHG3.4.21;Serine endopeptidases. 603
  • Gene: PCSK9
PAPQEQVTV3.4.21;Serine endopeptidases. 616
  • Gene: PCSK9
EQVTVACE3.4.21;Serine endopeptidases. 620
  • Gene: PCSK9
GWTLTGC3.4.21;Serine endopeptidases. 629
  • Gene: PCSK9
LGAYAVD3.4.21;Serine endopeptidases. 645
  • Gene: PCSK9
TCVVRSRDV3.4.21;Serine endopeptidases. 653
  • Gene: PCSK9

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQA
QAARRGYLTKILHVFH
GLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRV
MVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAA
CQRLARAGVVLVTAAGNFRDDACL
YSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMML
SAEPE
LTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSSFSRSGKRRGERM
EAQGGKLVCR
AHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASC
C
HAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ



DME EC Prediction for this protein is: 3.4.21.111
Check another protein