Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GKWMDGW3.5.3.4;Allantoicase. 62 -
DGWETRR3.5.3.4;Allantoicase. 66 -
AATPEEFEA3.5.3.4;Allantoicase. 134
  • Gene: ALLC
RLNIFPDGG3.5.3.4;Allantoicase. 184
  • Gene: ALLC
PDGGIARLRV3.5.3.4;Allantoicase. 189 -
LPAHKWK3.5.3.4;Allantoicase. 331
  • Gene: ALLC
WKPLLPVT3.5.3.4;Allantoicase. 336
  • Gene: ALLC
LLPVTKL3.5.3.4;Allantoicase. 339
  • Gene: ALLC
ELQDVITHA3.5.3.4;Allantoicase. 359
  • Gene: ALLC
PDGGVSR3.5.3.4;Allantoicase. 373 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MADAPKEGRLTRFLDFTQLMDMASESVGGKILFATDDFFAPAENLIKSDSPCFKEHEYTEFGKWMDGWETRRKRIPGHDWCVLRLGIQGVIRGFDVDVSY
FTGDYAPRVSIQAANLEEDKLPEIPERGTRTGA
AATPEEFEAIAELKSDDWSYLVPMTELKPGNPASGHNYFLVNSQQRWTHIRLNIFPDGGIARLRVFG
TGQKDWTATDPKEPADLVAIAFGGVCVGFSNAKFGHPNNIIGVGGAKSMADGWETARRLDRPPILENDENGILLVPGCEWAVFRLAHPGVITRIEIDTKY
FEGNAPDSCKVDGCILTTQEEEAVIRQKWI
LPAHKWKPLLPVTKLSPNQSHLFDSLTLELQDVITHARLTIVPDGGVSRLRLRGFPSSICLLRPREKPML
KFSVSFKANP



DME EC Prediction for this protein is: 3.5.3.4
Check another protein