Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
DAGMKRALGRRK3.1.1.23;Acylglycerol lipase. 55
  • Gene: ABD12
PYFIDLK3.1.1.23;Acylglycerol lipase. 109
  • Gene: ABD12
DQGLNHTCN3.1.1.23;Acylglycerol lipase. 119
  • Gene: ABD12
YLQPEEDV3.1.1.23;Acylglycerol lipase. 129
  • Gene: ABD12
VWWKNAQGKDQMWYEDAL3.1.1.23;Acylglycerol lipase. 147
  • Gene: ABD12
ILYLHGNAGTRGGDHRV3.1.1.23;Acylglycerol lipase. 171
  • Gene: ABD12
LYKVLSSLGYHVVTFDYRGWGDS3.1.1.23;Acylglycerol lipase. 189
  • Gene: ABD12
PSERGMT3.1.1.23;Acylglycerol lipase. 215
  • Gene: ABD12
YIWGHSLGTGVATNLVRRLC3.1.1.23;Acylglycerol lipase. 241
  • Active Site S=Serine at location 246 on the protein
  • Active Site Description: Charge relay system (By simila
  • Gene: ABD12
TPPDALILESPFTNIREEAKSHPFS3.1.1.23;Acylglycerol lipase. 264
  • Gene: ABD12
PGFDWFFLD3.1.1.23;Acylglycerol lipase. 295
  • Gene: ABD12
SGIKFAND3.1.1.23;Acylglycerol lipase. 308
  • Gene: ABD12
LILHAEDD3.1.1.23;Acylglycerol lipase. 326
  • Gene: ABD12
RSFRDFKVQF3.1.1.23;Acylglycerol lipase. 352
  • Gene: ABD12
DLGYRHKYIY3.1.1.23;Acylglycerol lipase. 367
  • Active Site H=Histidine at location 372 on the protein
  • Active Site Description: Charge relay system (By simila
  • Gene: ABD12
SPELPRILREFLG3.1.1.23;Acylglycerol lipase. 378
  • Gene: ABD12

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MRKRTEPVALEHERCAAAGSSSSGSAAAALDADCRLKQNLRLTGPAAAEPRCAADAGMKRALGRRKGVWLRLRKILFCVLGLYIAIPFLIKLCPGIQAKL
IFLNFVRV
PYFIDLKKPQDQGLNHTCNYYLQPEEDVTIGVWHTVPAVWWKNAQGKDQMWYEDALASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHV
VTFDYRGWGDS
VGTPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWF
FLD
PITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRHKYIYKSPELPRILREFLGKSEPEHQH



DME EC Prediction for this protein is: 3.1.1.23
Check another protein