Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
TGSGKTTQ3.6.1;In phosphorous-containing anhydrides. 78
  • Domain: Helicase ATP-binding
IKYMTDG3.6.1;In phosphorous-containing anhydrides. 146
  • Domain: Helicase ATP-binding
LDEAHERT3.6.1;In phosphorous-containing anhydrides. 172
  • Domain: Helicase ATP-binding
DEAHERTL3.6.1;In phosphorous-containing anhydrides. 173
  • Domain: Helicase ATP-binding
TDILFGL3.6.1;In phosphorous-containing anhydrides. 182
  • Domain: Helicase ATP-binding
RKCVISTNI3.6.1;In phosphorous-containing anhydrides. 339
  • Domain: Helicase C-terminal
TSLTIDGIRYV3.6.1;In phosphorous-containing anhydrides. 350
  • Domain: Helicase C-terminal
QRSGRAGRT3.6.1;In phosphorous-containing anhydrides. 392
  • Domain: Helicase C-terminal

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSRFPAVAGRAPRRQEEGERSRDLQEERLSAVCIADREEKGCTSQEGGTTPTFPIQKQRKKIIQAVRDNSFLIVTGNTGSGKTTQLPKYLYEAGFSQHGM
IGVTQPRKVAAISVAQRVAEEMKCTLGSKVGYQVRFDDCSSKETA
IKYMTDGCLLKHILGDPNLTKFSVIILDEAHERTLTTDILFGLLKKLFQEKSPNR
KEHLKVVVMSATMELAKLSAFFGNCPIFDIPGRLYPVREKFCNLIGPRDRENTAYIQAIVKVTMDIHLNEMAGDILVFLTGQFEIEKSCELLFQMAESVD
YDYDVQDTTLDGLLILPCYGSMTTDQQRRIFLPPPPGI
RKCVISTNISATSLTIDGIRYVVDGGFVKQLNHNPRLGLDILEVVPISKSEALQRSGRAGRT
SSGKCFRIYSKDFWNQCMPDHVIPEIKRTSLTSVVLTLKCLAIHDVIRFPYLDPPNERLILEALKQLYQCDAIDRSGHVTRLGLSMVEFPLPPHLTCAVI
KAASLDCEDLLLPIAAMLSVENVFIRPVDPEYQKEAEQRHRELAAKAGGFNDFATLAVIFEQCKSSGAPASWCQKHWIHWRCLFSAFRVEAQLRELIRKL
KQQSDFPKETFEGPKHEVLRRCLCAGYFKNVARRSVGRTFCTMDGRGSPVHIHPSSALHEQETKLEWIIFHEVLVTTKVYARIVCPIRYEWVRDLLPKLH
EFNAHDLSSVARREVREDARRRWTNKENVKQLKDGISKDVLKKMQRRNDDKSISDARARFLERKQQRTQDHSDTRKETG



DME EC Prediction for this protein is: 3.6.1
Check another protein