Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PLIAVPTT1.1.99.24;Hydroxyacid-oxoacid transhydrogenase. 180 -
GTGSETTGVAIFD1.1.99.24;Hydroxyacid-oxoacid transhydrogenase. 189
  • Gene: HOT
YQGSNPISD1.1.99.24;Hydroxyacid-oxoacid transhydrogenase. 272
  • Gene: HOT
LKRAVRNPDD1.1.99.24;Hydroxyacid-oxoacid transhydrogenase. 294
  • Gene: HOT
GFGNAGVHLCHG1.1.99.24;Hydroxyacid-oxoacid transhydrogenase. 320
  • Gene: HOT
VDHPLVPHGLSVVLTSPAVF1.1.99.24;Hydroxyacid-oxoacid transhydrogenase. 350
  • Gene: HOT
QMFPERHLE1.1.99.24;Hydroxyacid-oxoacid transhydrogenase. 374
  • Gene: HOT
LADTLRKFL1.1.99.24;Hydroxyacid-oxoacid transhydrogenase. 403
  • Gene: HOT
GTLPQER1.1.99.24;Hydroxyacid-oxoacid transhydrogenase. 436
  • Gene: HOT

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAAAARARVAYLLRQLQRAACQCPTHSHTYSQAPGLSPSGKTTDYAFEMAVSNIRYGAAVTKEVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKN
GIPFTVYDNVRVEPTDSSFMEAIEFAQKGAFDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLK
PLIAVPTTSGTGSETTGVAIF
D
YEHLKVKIGITSRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKRAVRN
PDD
LEARSHMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKMYKAKDYNVDHPLVPHGLSVVLTSPAVFTFTAQMFPERHLEMAEILGADTRTARIQDAG
LV
LADTLRKFLFDLDVDDGLAAVGYSKADIPALVKGTLPQERVTKLAPCPQSEEDLAALFEASMKLY



DME EC Prediction for this protein is: 1.1.99.24
Check another protein