Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LPLIEDSSNCDIVKATQYGIFERCKELVEAGYDVRQPD2.3.1;Transferring groups other than amino-acyl groups. 42
  • Gene: ZDH13
LHWAAIN2.3.1;Transferring groups other than amino-acyl groups. 86 -
DGEGFSSIHLAVLFQHMPIIAYLISK2.3.1;Transferring groups other than amino-acyl groups. 146
  • Gene: ZDH13
KVIGPEPTGFLLKFNPSL2.3.1;Transferring groups other than amino-acyl groups. 192
  • Gene: ZDH13
HQNTPLHWAVAAGNV2.3.1;Transferring groups other than amino-acyl groups. 216
  • Gene: ZDH13
AVDKLLEAGSSLDI2.3.1;Transferring groups other than amino-acyl groups. 232
  • Gene: ZDH13
KGETPLDMALQ2.3.1;Transferring groups other than amino-acyl groups. 249
  • Gene: ZDH13
KCELFLLL2.3.1;Transferring groups other than amino-acyl groups. 289
  • Gene: ZDH13
AFLYFFYKTWATDPGFTKASEEE2.3.1;Transferring groups other than amino-acyl groups. 386
  • Gene: ZDH13
LAETGSLD2.3.1;Transferring groups other than amino-acyl groups. 416 -
WTGRCIGFGNHH2.3.1;Transferring groups other than amino-acyl groups. 458
  • Gene: ZDH13
WIIYGSF2.3.1;Transferring groups other than amino-acyl groups. 484
  • Gene: ZDH13
FHFSWSTFLL2.3.1;Transferring groups other than amino-acyl groups. 529
  • Gene: ZDH13
HMKQTLSLRKTPYNLGF2.3.1;Transferring groups other than amino-acyl groups. 564
  • Gene: ZDH13
QNLADFFQCGCFGLVKPC2.3.1;Transferring groups other than amino-acyl groups. 582
  • Gene: ZDH13

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MEGPGLGSQCRNHSHGPHPPGFGRYGICAHENKELANAREALPLIEDSSNCDIVKATQYGIFERCKELVEAGYDVRQPDKENVSLLHWAAINNRLDLVKF
YISKGAVVDQLGGDLNSTPLHWAIRQGHLPMVILLLQHGADPTLI
DGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDVNGQTPLMLSAHKVIGPEPTG
FLLKFNPSL
NVVDKIHQNTPLHWAVAAGNVNAVDKLLEAGSSLDIQNVKGETPLDMALQNKNQLIIHMLKTEAKMRANQKFRLWRWLQKCELFLLLMLSV
ITMWAIGYILDFNSDSWLLKGCLLVTLFFLTSLFPRFLVGYKNLVYLPTAFLLSSVFWIFMTWFILFFPDLAGAPFYFSFIFSIV
AFLYFFYKTWATDPG
FTKASEEE
KKVNIITLAETGSLDFRTFCTSCLIRKPLRSLHCHVCNCCVARYDQHCLWTGRCIGFGNHHYYIFFLFFLSMVCGWIIYGSFIYLSSHCATT
FKEDGLWTYLNQIVACSPWVLYILMLAT
FHFSWSTFLLLNQLFQIAFLGLTSHERISLQKQSKHMKQTLSLRKTPYNLGFMQNLADFFQCGCFGLVKPCV
VDWTSQYTMVFHPAREKVLRSV



DME EC Prediction for this protein is: 2.3.1
Check another protein