Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
QVMWEPDSK6.2.1.16;Acetoacetate--CoA ligase. 16
  • Gene: AACS
DFWAEFWK6.2.1.16;Acetoacetate--CoA ligase. 60
  • Gene: AACS
YDEVVDTSK6.2.1.16;Acetoacetate--CoA ligase. 77
  • Gene: AACS
GVKKGDRV6.2.1;Acid--thiol ligases. 149 -
GDRVVGYLPN6.2.1.16;Acetoacetate--CoA ligase. 153
  • Gene: AACS
VEAMLAAASIGAIWS6.2.1.16;Acetoacetate--CoA ligase. 167
  • Gene: AACS
NGVLDRFSQIQPKLIFSVEAVVYNGKEH6.2.1.16;Acetoacetate--CoA ligase. 190
  • Gene: AACS
VVKGLPDLKKVVVIPYV6.2.1.16;Acetoacetate--CoA ligase. 226
  • Gene: AACS
SKIPNSVFL6.2.1.16;Acetoacetate--CoA ligase. 251
  • Gene: AACS
PQLEFEQLPF6.2.1.16;Acetoacetate--CoA ligase. 272
  • Gene: AACS
GTTGAPK6.2.1;Acid--thiol ligases. 292 -
VHSAGGTL6.2.1.16;Acetoacetate--CoA ligase. 301 -
GWMMWNW6.2.1.16;Acetoacetate--CoA ligase. 334 -
STGSPLK6.2.1.16;Acetoacetate--CoA ligase. 409 -
LLGSISGGTDIISCFMG6.2.1.16;Acetoacetate--CoA ligase. 431
  • Gene: AACS
PVYKGEIQAR6.2.1.16;Acetoacetate--CoA ligase. 453
  • Gene: AACS
GEIQARNLGMAVE6.2.1.16;Acetoacetate--CoA ligase. 457
  • Gene: AACS
MLGRSDGTLNPNGVRFGSSEIYNIVE6.2.1.16;Acetoacetate--CoA ligase. 536
  • Gene: AACS
DSLCVPQYN6.2.1.16;Acetoacetate--CoA ligase. 568
  • Gene: AACS
GKKVEVAVKQ6.2.1.16;Acetoacetate--CoA ligase. 632 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSKEERPGREEILECQVMWEPDSKKNTQMDRFRAAVGAACGLALESYDDLYHWSVESYSDFWAEFWKFSGIVFSRVYDEVVDTSKGIADVPEWFKGSRLN
YAENLLRHKENDRVALYIAREGKEEIVKVTFEELRQEVALFAAAMRKM
GVKKGDRVVGYLPNSEHAVEAMLAAASIGAIWSSTSPDFGVNGVLDRFSQIQ
PKLIFSVEAVVYNGKEH
NHMEKLQQVVKGLPDLKKVVVIPYVSSRENIDLSKIPNSVFLDDFLATGTSEQAPQLEFEQLPFSHPLFIMFSSGTTGAPKCM
VHSAGGTLIQHLKEHLLHGNMTSSDILLCYTTVGWMMWNWMVSLLATGAAMVLYDGSPLVPTPNVLWDLVDRIGITVLVTGAKWLSVLEEKAMKPVETHS
LQMLHTIL
STGSPLKAQSYEYVYRCIKSSILLGSISGGTDIISCFMGHNFSLPVYKGEIQARNLGMAVEAWNEEGKAVWGESGELVCTKPIPCQPTHFWN
DENGNKYRKAYFSKFPGIWAHGDYCRINPKTGGIV
MLGRSDGTLNPNGVRFGSSEIYNIVESFEEVEDSLCVPQYNKYREERVILFLKMASGHAFQPDLV
KRIRDAIRMGLSARHVPSLILETKGIPYTLN
GKKVEVAVKQIIAGKAVEQGGAFSNPETLDLYRDIPELQGF



DME EC Prediction for this protein is: 6.2.1.16
Check another protein