Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PEQPVTLR3.1.2.2;Palmitoyl-CoA hydrolase. 28 -
AHARYRAD3.1.2.2;Palmitoyl-CoA hydrolase. 48 -
PALGGSF3.1.2.2;Palmitoyl-CoA hydrolase. 66 -
VELEVLDGH3.1.2.2;Palmitoyl-CoA hydrolase. 104 -
GLLEYRASLLAGKGFAVMALAY3.1.2.2;Palmitoyl-CoA hydrolase. 169 -
GLLGISKG3.1.2.2;Palmitoyl-CoA hydrolase. 227
  • Active Site S=Serine at location 232 on the protein
  • Active Site Description: Charge relay system (By simila
MASFLKGITA3.1.2.2;Palmitoyl-CoA hydrolase. 241 -
DDHNWKS3.1.2.2;Palmitoyl-CoA hydrolase. 325
  • Active Site D=Aspartic acid at location 326 on the protein
  • Active Site Description: Charge relay system (By simila
WKSEFYA3.1.2.2;Palmitoyl-CoA hydrolase. 329 -
IEPPYFP3.1.2.2;Palmitoyl-CoA hydrolase. 362 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAATLILEPAGRCCWDEPVRIAVRGLAPEQPVTLRASLRDEKGALFQAHARYRADTLGELDLERAPALGGSFAGLEPMGLLWALEPEKPLVRLVKRDVRT
PLA
VELEVLDGHDPDPGRLLCRVRHERYFLPPGVRREPVRAGRVRGTLFLPPEPGPFPGIVDMFGTGGGLLEYRASLLAGKGFAVMALAYYNYEDLPKTM
ETLHLEYFEEAVNYLLSHPEVKGPGV
GLLGISKGGELCLSMASFLKGITAAVVINGSVANVGGTLRYKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPL
EGPDQKSFIPVERAESTFLFLVGQ
DDHNWKSEFYANEACKRLQAHGRRKPQIICYPETGHYIEPPYFPLCRASLHALVGSPIIWGGEPRAHAMAQVDAWK
QLQTFFHKHLGGHEGTIPSKV



DME EC Prediction for this protein is: 3.1.2.2
Check another protein