Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
NRGTFIKVGQHL2.7.11;Protein-serine/threonine kinases. 96
  • Gene: ADCK1
QVIREDLGKEI2.7.11;Protein-serine/threonine kinases. 139
  • Gene: ADCK1
DGRTVAVK2.7.11;Protein-serine/threonine kinases. 176
  • Domain: Protein kinase
NEGRNAE2.7.11;Protein-serine/threonine kinases. 235
  • Domain: Protein kinase
VPRQMLL2.7.11;Protein-serine/threonine kinases. 431
  • Domain: Protein kinase
  • Gene: ADCK1
SSFLNMSRCC2.7.11;Protein-serine/threonine kinases. 459
  • Domain: Protein kinase
  • Gene: ADCK1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MARKALKLASWTSMALAASGIYFYSNKYLDPNDFGAVRVGRAVATTAVISYDYLTSLKSVPYGSEEYLQLRSKSWPVFLQVHLRSARRLCELCCANRGTF
IKVGQHL
GALDYLLPEEYTSTLKVLHSQAPQSSMQEIRQVIREDLGKEIHDLFQSFDDTPLGTASLAQVHKAVLHDGRTVAVKVQHPKVRAQSSKDILLM
EVLVLAVKQLFPEFEFMWLVDEAKKNLPLELDFL
NEGRNAEKVSQMLRHFDFLKVPRIHWDLSTERVLLMEFVDGGQVNDRDYMERNKIDVNEISRHLGK
MYSEMIFVNGFVHCDPHPGNVLVRKHPGTGKAEIVLLDHGLYQMLTEEFRLNYCHLWQSLIWTDMKRVKEYSQRLGAGDLYPLFACMLTARSWDSVNRGI
SQAPVTATEDLEIRNNAANYLPQISHLLNH
VPRQMLLILKTNDLLRGIEAALGTRASASSFLNMSRCCIRALAEHKKKNTCSFFRRTQISFSEAFNLWQI
NLHELILRVKGLKLADRVLALICWLFPAPL



DME EC Prediction for this protein is: 2.7.11
Check another protein