Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
TKNATRHAEMVA3.5.4;In cyclic amidines. 65
  • Active Site E=Glutamic acid at location 73 on the protein
  • Active Site Description: Proton donor (By similarity).
  • Metal Site H=Histidine at location 71 on the protein
  • Metal Site Description: Zinc; catalytic (By similarity
  • Gene: ADAT2
LYVTVEPC3.5.4;In cyclic amidines. 100 -
RFGGCGSV3.5.4;In cyclic amidines. 130 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MEAKAAPKPAASGACSVSAEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVL
YVTVEPC
IMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS



DME EC Prediction for this protein is: 3.5.4
Check another protein